mast.farntrans5.zoops

来自「EM算法的改进」· ZOOPS 代码 · 共 297 行

ZOOPS
297 行
字号
********************************************************************************MAST - Motif Alignment and Search Tool********************************************************************************	MAST version 3.5.1 (Release date: 2006/02/01 02:08:55)	For further information on how to interpret these results or to get	a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE********************************************************************************	If you use this program in your research, please cite:	Timothy L. Bailey and Michael Gribskov,	"Combining evidence using p-values: application to sequence homology	searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS********************************************************************************	DATABASE /home/meme/TEST/tests/farntrans5.s (peptide)	Last updated on Tue Jan 31 18:16:52 2006	Database contains 5 sequences, 1900 residues	MOTIFS /home/meme/TEST/tests/meme.farntrans5.zoops (peptide)	MOTIF WIDTH BEST POSSIBLE MATCH	----- ----- -------------------	  1    32   QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR	  2    50   GEVDTRFVYCALSVASLLNILTPELVEGAIEFVLRCQNFDGGFGCCPGAE	PAIRWISE MOTIF CORRELATIONS:	MOTIF     1	----- -----	   2   0.30	No overly similar pairs (correlation > 0.60) found.	Random model letter frequencies (from non-redundant database):	A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 	L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 	W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES********************************************************************************	- Each of the following 5 sequences has E-value less than 10.	- The E-value of a sequence is the expected number of sequences	  in a random database of the same size that would match the motifs as	  well as the sequence does and is equal to the combined p-value of the	  sequence times the number of sequences in the database.	- The combined p-value of a sequence measures the strength of the	  match of the sequence to all the motifs and is calculated by	    o finding the score of the single best match of each motif	      to the sequence (best matches may overlap),	    o calculating the sequence p-value of each score,	    o forming the product of the p-values,	    o taking the p-value of the product.	- The sequence p-value of a score is defined as the	  probability of a random sequence of the same length containing	  some match with as good or better a score.	- The score for the match of a position in a sequence to a motif	  is computed by by summing the appropriate entry from each column of	  the position-dependent scoring matrix that represents the motif.	- Sequences shorter than one or more of the motifs are skipped.	- The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME                      DESCRIPTION                   E-VALUE  LENGTH-------------                      -----------                   -------- ------BET2_YEAST                         YPT1/SEC4 PROTEINS GERANY...    2.1e-70    325RATRABGERB                         Rat rab geranylgeranyl tr...    1.7e-67    331PFTB_RAT                           PROTEIN FARNESYLTRANSFERA...    9.8e-65    437RAM1_YEAST                         PROTEIN FARNESYLTRANSFERA...    1.1e-63    431CAL1_YEAST                         RAS PROTEINS GERANYLGERAN...    7.3e-25    376****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS********************************************************************************	- The ordering and spacing of all non-overlapping motif occurrences	  are shown for each high-scoring sequence listed in Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001.	- The POSITION p-value of a match is the probability of	  a single random subsequence of the length of the motif	  scoring at least as well as the observed match.	- For each sequence, all motif occurrences are shown unless there	  are overlaps.  In that case, a motif occurrence is shown only if its	  p-value is less than the product of the p-values of the other	  (lower-numbered) motif occurrences that it overlaps.	- The table also shows the E-value of each sequence.	- Spacers and motif occurences are indicated by	   o -d-    `d' residues separate the end of the preceding motif 		    occurrence and the start of the following motif occurrence	   o [n]  occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME                      E-VALUE   MOTIF DIAGRAM-------------                      --------  -------------BET2_YEAST                          2.1e-70  31_[2]_50_[2]_37_[1]_17_[1]_26RATRABGERB                          1.7e-67  42_[2]_46_[2]_34_[1]_17_[1]_28PFTB_RAT                            9.8e-65  133_[1]_31_[2]_35_[1]_30_[1]_62RAM1_YEAST                          1.1e-63  205_[2]_36_[1]_108CAL1_YEAST                          7.3e-25  212_[2]_8_[1]_20_[1]_22****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES********************************************************************************	- The positions and p-values of the non-overlapping motif occurrences	  are shown above the actual sequence for each of the high-scoring	  sequences from Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001 as 	  defined in Section II.	- For each sequence, the first line specifies the name of the sequence.	- The second (and possibly more) lines give a description of the 	  sequence.	- Following the description line(s) is a line giving the length, 	  combined p-value, and E-value of the sequence as defined in Section I.	- The next line reproduces the motif diagram from Section II.	- The entire sequence is printed on the following lines.	- Motif occurrences are indicated directly above their positions in the	  sequence on lines showing	   o the motif number of the occurrence,	   o the position p-value of the occurrence,	   o the best possible match to the motif, and	   o columns whose match to the motif has a positive score (indicated 	     by a plus sign).********************************************************************************BET2_YEAST  YPT1/SEC4 PROTEINS GERANYLGERANYLTRANSFERASE BETA SUBUNIT (EC 2.  LENGTH = 325  COMBINED P-VALUE = 4.14e-71  E-VALUE =  2.1e-70  DIAGRAM: 31_[2]_50_[2]_37_[1]_17_[1]_26                                    [2]                                    2.3e-05                                    GEVDTRFVYCALSVASLLNILTPELVEGAIEFVLRCQNFDGGFG                                          +++  ++++  +      + + ++ +++++     +1    MSGSLTLLKEKHIRYIESLDTNKHNFEYWLTEHLRLNGIYWGLTALCVLDSPETFVKEEVISFVLSCWDDKYGAF                                                             [2]                                                             8.6e-45     CCPGAE                                                  GEVDTRFVYCALSVASLLN     +                                                       +++++++++ +++++++++76   APFPRHDAHLLTTLSAVQILATYDALDVLGKDRKVRLISFIRGNQLEDGSFQGDRFGEVDTRFVYTALSALSILG                                                                         [1]                                                                         3.5e-34     ILTPELVEGAIEFVLRCQNFDGGFGCCPGAE                                     QQPEGGF     +++++++ +++++++++++++++++++++++                                     +++++++151  ELTSEVVDPAVDFVLKCYNFDGGFGLCPNAESHAAQAFTCLGALAIANKLDMLSDDQLEEIGWWLCERQLPEGGL                                               [1]                                               1.0e-06     NGRPNKLPDVCYSWWVLGSLPIIGR                 QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR     +++++++++++++++++++++++++                     ++   +++  +++  +    + + +++226  NGRPSKLPDVCYSWWVLSSLAIIGRLDWINYEKLTEFILKCQDEKKGGISDRPENEVDVFHTVFGVAGLSLMGYDRATRABGERB  Rat rab geranylgeranyl transferase beta-subunit  LENGTH = 331  COMBINED P-VALUE = 3.40e-68  E-VALUE =  1.7e-67  DIAGRAM: 42_[2]_46_[2]_34_[1]_17_[1]_28                                               [2]                                               4.7e-09                                               GEVDTRFVYCALSVASLLNILTPELVEGAIEFV                                                     +++  +++  +++ +   + +  + ++1    MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFI                                                                    [2]                                                                    3.3e-43     LRCQNFDGGFGCCPGAE                                              GEVDTRFVYCAL     ++++   ++  +  +                                                ++++++++++++76   KSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAV                                                                             [1]                                                                             7.6     SVASLLNILTPELVEGAIEFVLRCQNFDGGFGCCPGAE                                  QQP     ++++++++++++++++++++++++++++++++++++++                                  +++151  ATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLP                                                   [1]     e-33                                          2.1e-07     EGGFNGRPNKLPDVCYSWWVLGSLPIIGR                 QQPEGGFNGRPNKLPDVCYSWWVLGSLPI     +++++++++++++++++++++++++++++                   + +++  ++  +++   +    + + +226  SGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL               IGR     ++301  LGEEQIKPVSPVFCMPEEVLQRVNVQPELVSPFTB_RAT  PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT (EC 2.5.1.-) (CAAX FARNES  LENGTH = 437  COMBINED P-VALUE = 1.95e-65  E-VALUE =  9.8e-65  DIAGRAM: 133_[1]_31_[2]_35_[1]_30_[1]_62                                                               [1]                                                               5.4e-09                                                               QQPEGGFNGRPNKLPDV                                                               +++++++ + +   +76   EKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHL                                                   [2]                                                   4.2e-44     CYSWWVLGSLPIIGR                               GEVDTRFVYCALSVASLLNILTPELVEGA       ++   + + +++                                +++++++++++++++++++++++++++++151  APTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGT                                                             [1]                                                             1.9e-29     IEFVLRCQNFDGGFGCCPGAE                                   QQPEGGFNGRPNKLPDVCY     +++++++++++++++++++++                                   +++++++++++++++++++226  AEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY                                                [1]                                                6.3e-07     SWWVLGSLPIIGR                              QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR     ++++++ ++++++                              + + +++   + +  +   +  +++ + +301  SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHRAM1_YEAST  PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT (EC 2.5.1.-) (CAAX FARN  LENGTH = 431  COMBINED P-VALUE = 2.14e-64  E-VALUE =  1.1e-63  DIAGRAM: 205_[2]_36_[1]_108                                                            [2]                                                            3.3e-45                                                            GEVDTRFVYCALSVASLLNI                                                            ++++++++++++++++++++151  PGQLSHLASTYAAINALSLCDNIDGCWDRIDRKGIYQWLISLKEPNGGFKTCLEVGEVDTRGIYCALSIATLLNI                                                                       [1]                                                                       2.8e-27     LTPELVEGAIEFVLRCQNFDGGFGCCPGAE                                    QQPEGGFNG     +++++++++++++++++++++++++++++                                      ++++++++226  LTEELTEGVLNYLKNCQNYEGGFGSCPHVDEAHGGYTFCATASLAILRSMDQINVEKLLEWSSARQLQEERGFCG               RPNKLPDVCYSWWVLGSLPIIGR     ++++++++++++++++++++++301  RSNKLVDGCYSFWVGGSAAILEAFGYGQCFNKHALRDYILYCCQEKEQPGLRDKPGAHSDFYHTNYCLLGLAVAECAL1_YEAST  RAS PROTEINS GERANYLGERANYLTRANSFERASE (EC 2.5.1.-) (PROTEIN GER  LENGTH = 376  COMBINED P-VALUE = 1.46e-25  E-VALUE =  7.3e-25  DIAGRAM: 212_[2]_8_[1]_20_[1]_22                                                                   [2]                                                                   7.4e-06                                                                   GEVDTRFVYCALS                                                                    +       ++++151  DYKTNCGSSVDSDDLRFCYIAVAILYICGCRSKEDFDEYIDTEKLLGYIMSQQCYNGAFGAHNEPHSGYTSCALS                                                  [1]                                                  2.8e-27     VASLLNILTPELVEGAIEFVLRCQNFDGGFGCCPGAE        QQPEGGFNGRPNKLPDVCYSWWVLGSLPII     +++++  +         + +           ++   +        ++++++++++++++++++++++++++++++226  TLALLSSLEKLSDKFKEDTITWLLHRQVSSHGCMKFESELNASYDQSDDGGFQGRENKFADTCYAFWCLNSLHLL                           [1]                           6.4e-05     GR                    QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR     ++                        +++    +  ++   +    + +++++301  TKDWKMLCQTELVTNYLLDRTQKTLTGGFSKNDEEDADLYHSCLGSAALALIEGKFNGELCIPQEIFNDFSKRCC********************************************************************************CPU: rocks-155.sdsc.eduTime 0.030995 secs.mast meme.farntrans5.zoops

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?