mast.lipocalin.zoops

来自「EM算法的改进」· ZOOPS 代码 · 共 240 行

ZOOPS
240 行
字号
********************************************************************************MAST - Motif Alignment and Search Tool********************************************************************************	MAST version 3.5.1 (Release date: 2006/02/01 02:08:55)	For further information on how to interpret these results or to get	a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE********************************************************************************	If you use this program in your research, please cite:	Timothy L. Bailey and Michael Gribskov,	"Combining evidence using p-values: application to sequence homology	searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS********************************************************************************	DATABASE /home/meme/TEST/tests/lipocalin.s (peptide)	Last updated on Tue Jan 31 18:16:52 2006	Database contains 5 sequences, 903 residues	MOTIFS /home/meme/TEST/tests/meme.lipocalin.zoops (peptide)	MOTIF WIDTH BEST POSSIBLE MATCH	----- ----- -------------------	  1    26   GACPAVRPMRNFDIQKFAGTWHEIAK	  2    20   NNVFWILDTDYKNYLIQYMC	PAIRWISE MOTIF CORRELATIONS:	MOTIF     1	----- -----	   2   0.25	No overly similar pairs (correlation > 0.60) found.	Random model letter frequencies (from non-redundant database):	A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 	L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 	W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES********************************************************************************	- Each of the following 5 sequences has E-value less than 10.	- The E-value of a sequence is the expected number of sequences	  in a random database of the same size that would match the motifs as	  well as the sequence does and is equal to the combined p-value of the	  sequence times the number of sequences in the database.	- The combined p-value of a sequence measures the strength of the	  match of the sequence to all the motifs and is calculated by	    o finding the score of the single best match of each motif	      to the sequence (best matches may overlap),	    o calculating the sequence p-value of each score,	    o forming the product of the p-values,	    o taking the p-value of the product.	- The sequence p-value of a score is defined as the	  probability of a random sequence of the same length containing	  some match with as good or better a score.	- The score for the match of a position in a sequence to a motif	  is computed by by summing the appropriate entry from each column of	  the position-dependent scoring matrix that represents the motif.	- Sequences shorter than one or more of the motifs are skipped.	- The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME                      DESCRIPTION                   E-VALUE  LENGTH-------------                      -----------                   -------- ------ICYA_MANSE                                                        1.7e-36    189BBP_PIEBR                                                         1.9e-36    173RETB_BOVIN                                                        8.6e-29    183LACB_BOVIN                                                        3.5e-24    178MUP2_MOUSE                                                        6.9e-24    180****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS********************************************************************************	- The ordering and spacing of all non-overlapping motif occurrences	  are shown for each high-scoring sequence listed in Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001.	- The POSITION p-value of a match is the probability of	  a single random subsequence of the length of the motif	  scoring at least as well as the observed match.	- For each sequence, all motif occurrences are shown unless there	  are overlaps.  In that case, a motif occurrence is shown only if its	  p-value is less than the product of the p-values of the other	  (lower-numbered) motif occurrences that it overlaps.	- The table also shows the E-value of each sequence.	- Spacers and motif occurences are indicated by	   o -d-    `d' residues separate the end of the preceding motif 		    occurrence and the start of the following motif occurrence	   o [n]  occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME                      E-VALUE   MOTIF DIAGRAM-------------                      --------  -------------ICYA_MANSE                          1.7e-36  6_[1]_67_[2]_70BBP_PIEBR                           1.9e-36  5_[1]_64_[2]_58RETB_BOVIN                          8.6e-29  3_[1]_71_[2]_63LACB_BOVIN                          3.5e-24  14_[1]_64_[2]_54MUP2_MOUSE                          6.9e-24  16_[1]_62_[2]_56****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES********************************************************************************	- The positions and p-values of the non-overlapping motif occurrences	  are shown above the actual sequence for each of the high-scoring	  sequences from Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001 as 	  defined in Section II.	- For each sequence, the first line specifies the name of the sequence.	- The second (and possibly more) lines give a description of the 	  sequence.	- Following the description line(s) is a line giving the length, 	  combined p-value, and E-value of the sequence as defined in Section I.	- The next line reproduces the motif diagram from Section II.	- The entire sequence is printed on the following lines.	- Motif occurrences are indicated directly above their positions in the	  sequence on lines showing	   o the motif number of the occurrence,	   o the position p-value of the occurrence,	   o the best possible match to the motif, and	   o columns whose match to the motif has a positive score (indicated 	     by a plus sign).********************************************************************************ICYA_MANSE    LENGTH = 189  COMBINED P-VALUE = 3.46e-37  E-VALUE =  1.7e-36  DIAGRAM: 6_[1]_67_[2]_70           [1]           3.0e-24           GACPAVRPMRNFDIQKFAGTWHEIAK           ++++++++++++++++++++++++++1    GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAKLPLENENQGKCTIAEYKYDGKKASVYNSFVSNGVKEYMEGDLE                             [2]                             4.6e-20                             NNVFWILDTDYKNYLIQYMC                             + ++++++++++++++++++76   IAPDAKYTKQGKYVMTFKFGQRVVNLVPWVLATDYKNYAINYNCDYHPDKKAHSIHAWILSKSKVLEGNTKEVVDBBP_PIEBR    LENGTH = 173  COMBINED P-VALUE = 3.89e-37  E-VALUE =  1.9e-36  DIAGRAM: 5_[1]_64_[2]_58          [1]          1.5e-24          GACPAVRPMRNFDIQKFAGTWHEIAK          ++++++++++++++++++++++++++1    NVYHDGACPEVKPVDNFDWSNYHGKWWEVAKYPNSVEKYGKCGWAEYTPEGKSVKVSNYHVIHGKEYFIEGTAYP                         [2]                         1.2e-19                         NNVFWILDTDYKNYLIQYMC                         ++++++++++++++++++++76   VGDSKIGKIYHKLTYGGVTKENVFNVLSTDNKNYIIGYYCKYDEDKKGHQDFVWVLSRSKVLTGEAKTAVENYLIRETB_BOVIN    LENGTH = 183  COMBINED P-VALUE = 1.72e-29  E-VALUE =  8.6e-29  DIAGRAM: 3_[1]_71_[2]_63        [1]        2.5e-19        GACPAVRPMRNFDIQKFAGTWHEIAK        +++++++++++++ ++++++++++++1    ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVG                              [2]                              3.7e-17                              NNVFWILDTDYKNYLIQYMC                              + ++++++++++++++++++76   TFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQKLACB_BOVIN    LENGTH = 178  COMBINED P-VALUE = 7.03e-25  E-VALUE =  3.5e-24  DIAGRAM: 14_[1]_64_[2]_54                   [1]                   3.1e-18                   GACPAVRPMRNFDIQKFAGTWHEIAK                   +++++++++++ ++++++++++++++1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQ                                  [2]                                  1.5e-13                                  NNVFWILDTDYKNYLIQYMC                                  ++++ +++++++ ++++++76   KWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEMUP2_MOUSE    LENGTH = 180  COMBINED P-VALUE = 1.38e-24  E-VALUE =  6.9e-24  DIAGRAM: 16_[1]_62_[2]_56                     [1]                     8.4e-17                     GACPAVRPMRNFDIQKFAGTWHEIAK                     ++++++++++++ +++++++++++++1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFH                                  [2]                                  1.1e-14                                  NNVFWILDTDYKNYLIQYMC                                  +++++++++++++++++++76   TVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKE********************************************************************************CPU: rocks-155.sdsc.eduTime 0.009998 secs.mast meme.lipocalin.zoops

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?