📄 mast.adh.tcm
字号:
********************************************************************************MAST - Motif Alignment and Search Tool******************************************************************************** MAST version 3.5.1 (Release date: 2006/02/01 02:08:55) For further information on how to interpret these results or to get a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE******************************************************************************** If you use this program in your research, please cite: Timothy L. Bailey and Michael Gribskov, "Combining evidence using p-values: application to sequence homology searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS******************************************************************************** DATABASE /home/meme/TEST/tests/adh.s (peptide) Last updated on Tue Jan 31 18:16:52 2006 Database contains 33 sequences, 9996 residues MOTIFS /home/meme/TEST/tests/meme.adh.tcm (peptide) MOTIF WIDTH BEST POSSIBLE MATCH ----- ----- ------------------- 1 22 YCASKFAVRGFTRSMAMEYAPY 2 25 QGKVVLITGCSSGIGKATAKHFHKE PAIRWISE MOTIF CORRELATIONS: MOTIF 1 ----- ----- 2 0.34 No overly similar pairs (correlation > 0.60) found. Random model letter frequencies (from non-redundant database): A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES******************************************************************************** - Each of the following 33 sequences has E-value less than 10. - The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database. - The combined p-value of a sequence measures the strength of the match of the sequence to all the motifs and is calculated by o finding the score of the single best match of each motif to the sequence (best matches may overlap), o calculating the sequence p-value of each score, o forming the product of the p-values, o taking the p-value of the product. - The sequence p-value of a score is defined as the probability of a random sequence of the same length containing some match with as good or better a score. - The score for the match of a position in a sequence to a motif is computed by by summing the appropriate entry from each column of the position-dependent scoring matrix that represents the motif. - Sequences shorter than one or more of the motifs are skipped. - The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME DESCRIPTION E-VALUE LENGTH------------- ----------- -------- ------YRTP_BACSU HYPOTHETICAL 25.3 KD PROT... 2.3e-30 238BUDC_KLETE ACETOIN(DIACETYL) REDUCTA... 8.5e-29 241YINL_LISMO HYPOTHETICAL 26.8 KD PROT... 1.1e-25 248DHII_HUMAN CORTICOSTEROID 11-BETA-DE... 1e-24 292FVT1_HUMAN no comment 3.4e-24 332HDE_CANTR HYDRATASE-DEHYDROGENASE-E... 5.8e-24 906AP27_MOUSE ADIPOCYTE P27 PROTEIN (AP... 1.1e-23 244DHGB_BACME GLUCOSE 1-DEHYDROGENASE B... 1.2e-22 2623BHD_COMTE 3-BETA-HYDROXYSTEROID DEH... 1.8e-22 253BPHB_PSEPS BIPHENYL-CIS-DIOL DEHYDRO... 1.8e-22 275FIXR_BRAJA FIXR PROTEIN 1.9e-22 278DHB3_HUMAN no comment 3.2e-22 310DHES_HUMAN ESTRADIOL 17 BETA-DEHYDRO... 6.8e-22 327RIDH_KLEAE RIBITOL 2-DEHYDROGENASE (... 8.2e-22 249HDHA_ECOLI 7-ALPHA-HYDROXYSTEROID DE... 8.5e-22 255NODG_RHIME NODULATION PROTEIN G (HOS... 9.2e-22 245DHB2_HUMAN no comment 1.6e-21 387ENTA_ECOLI 2,3-DIHYDRO-2,3-DIHYDROXY... 4.7e-21 248DHMA_FLAS1 N-ACYLMANNOSAMINE 1-DEHYD... 8.9e-21 270HMTR_LEIMA no comment 1.7e-20 287BA72_EUBSP 7-ALPHA-HYDROXYSTEROID DE... 3.3e-20 249BDH_HUMAN D-BETA-HYDROXYBUTYRATE DE... 6.2e-20 343GUTD_ECOLI SORBITOL-6-PHOSPHATE 2-DE... 7e-19 2592BHD_STREX 20-BETA-HYDROXYSTEROID DE... 8.4e-19 255LIGD_PSEPA C ALPHA-DEHYDROGENASE (EC... 2.4e-17 305RFBB_NEIGO no comment 4.3e-17 346ADH_DROME ALCOHOL DEHYDROGENASE (EC... 2.8e-14 255DHCA_HUMAN no comment 1.1e-13 276MAS1_AGRRA no comment 3.6e-11 476PCR_PEA no comment 9.6e-11 399YURA_MYXXA no comment 1.1e-09 258CSGA_MYXXA no comment 3.5e-08 166FABI_ECOLI no comment 6.4e-07 262****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS******************************************************************************** - The ordering and spacing of all non-overlapping motif occurrences are shown for each high-scoring sequence listed in Section I. - A motif occurrence is defined as a position in the sequence whose match to the motif has POSITION p-value less than 0.0001. - The POSITION p-value of a match is the probability of a single random subsequence of the length of the motif scoring at least as well as the observed match. - For each sequence, all motif occurrences are shown unless there are overlaps. In that case, a motif occurrence is shown only if its p-value is less than the product of the p-values of the other (lower-numbered) motif occurrences that it overlaps. - The table also shows the E-value of each sequence. - Spacers and motif occurences are indicated by o -d- `d' residues separate the end of the preceding motif occurrence and the start of the following motif occurrence o [n] occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME E-VALUE MOTIF DIAGRAM------------- -------- -------------YRTP_BACSU 2.3e-30 4_[2]_125_[1]_62BUDC_KLETE 8.5e-29 [2]_126_[1]_68YINL_LISMO 1.1e-25 3_[2]_125_[1]_73DHII_HUMAN 1e-24 32_[2]_125_[1]_88FVT1_HUMAN 3.4e-24 30_[2]_130_[1]_125HDE_CANTR 5.8e-24 6_[2]_131_[1]_136_[2]_121_[1]_ 240_[2]_153AP27_MOUSE 1.1e-23 5_[2]_118_[1]_74DHGB_BACME 1.2e-22 5_[2]_129_[1]_813BHD_COMTE 1.8e-22 4_[2]_121_[1]_81BPHB_PSEPS 1.8e-22 3_[2]_124_[1]_101FIXR_BRAJA 1.9e-22 34_[2]_129_[1]_68DHB3_HUMAN 3.2e-22 46_[2]_126_[1]_91DHES_HUMAN 6.8e-22 [2]_129_[1]_151RIDH_KLEAE 8.2e-22 12_[2]_122_[1]_68HDHA_ECOLI 8.5e-22 9_[2]_124_[1]_75NODG_RHIME 9.2e-22 4_[2]_122_[1]_72DHB2_HUMAN 1.6e-21 80_[2]_126_[1]_134ENTA_ECOLI 4.7e-21 3_[2]_115_[1]_83DHMA_FLAS1 8.9e-21 12_[2]_127_[1]_84HMTR_LEIMA 1.7e-20 4_[2]_163_[1]_73BA72_EUBSP 3.3e-20 4_[2]_127_[1]_71BDH_HUMAN 6.2e-20 53_[2]_129_[1]_114GUTD_ECOLI 7e-19 [2]_128_[1]_842BHD_STREX 8.4e-19 4_[2]_122_[1]_82LIGD_PSEPA 2.4e-17 4_[2]_127_[1]_127RFBB_NEIGO 4.3e-17 4_[2]_135_[1]_160ADH_DROME 2.8e-14 4_[2]_122_[1]_82DHCA_HUMAN 1.1e-13 2_[2]_165_[1]_62MAS1_AGRRA 3.6e-11 243_[2]_123_[1]_63PCR_PEA 9.6e-11 84_[2]_290YURA_MYXXA 1.1e-09 159_[1]_77CSGA_MYXXA 3.5e-08 87_[1]_57FABI_ECOLI 6.4e-07 4_[2]_129_[1]_82****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES******************************************************************************** - The positions and p-values of the non-overlapping motif occurrences are shown above the actual sequence for each of the high-scoring sequences from Section I. - A motif occurrence is defined as a position in the sequence whose match to the motif has POSITION p-value less than 0.0001 as defined in Section II. - For each sequence, the first line specifies the name of the sequence. - The second (and possibly more) lines give a description of the sequence. - Following the description line(s) is a line giving the length, combined p-value, and E-value of the sequence as defined in Section I. - The next line reproduces the motif diagram from Section II. - The entire sequence is printed on the following lines. - Motif occurrences are indicated directly above their positions in the sequence on lines showing o the motif number of the occurrence, o the position p-value of the occurrence, o the best possible match to the motif, and o columns whose match to the motif has a positive score (indicated by a plus sign).********************************************************************************YRTP_BACSU HYPOTHETICAL 25.3 KD PROTEIN IN RTP 5'REGION (ORF238) LENGTH = 238 COMBINED P-VALUE = 6.86e-32 E-VALUE = 2.3e-30 DIAGRAM: 4_[2]_125_[1]_62 [2] 2.9e-20 QGKVVLITGCSSGIGKATAKHFHKE +++ +++++++++++++++++++++1 MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFAAADVKDADQVNQAVA [1] 6.6e-19 YCASKFAVRGFTRSMAMEYAPY ++++++++ +++++++++++++151 VTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPRBUDC_KLETE ACETOIN(DIACETYL) REDUCTASE (EC 1.1.1.5) (ACETOIN DEHYDROGENASE) LENGTH = 241 COMBINED P-VALUE = 2.57e-30 E-VALUE = 8.5e-29 DIAGRAM: [2]_126_[1]_68 [2] 1.6e-20 QGKVVLITGCSSGIGKATAKHFHKE +++++++++++++++++++++++++1 MQKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATATAVAAEINQAGGRAVAIKVDVSRRDQVFAAVEQARK [1] 4.7e-17 YCASKFAVRGFTRSMAMEYAPY +++++++++++++++++++++151 VYSSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKTPMWAEIDRQCRKRRANRWATARLNLPNASPLAACRSLKYINL_LISMO HYPOTHETICAL 26.8 KD PROTEIN IN INLA 5'REGION (ORFA) LENGTH = 248 COMBINED P-VALUE = 3.19e-27 E-VALUE = 1.1e-25 DIAGRAM: 3_[2]_125_[1]_73 [2] 2.9e-20 QGKVVLITGCSSGIGKATAKHFHKE ++++++++++++++++++++ ++++1 MTIKNKVIIITGASSGIGKATALLLAEKGAKLVLAARRVEKLEKIVQIIKANSGEAIFAKTDVTKREDNKKLVEL [1] 3.3e-14 YCASKFAVRGFTRSMAMEYAPY +++++++++ +++ ++++ +++151 GAVYGATKWAVRDLMEVLRMESAQEGTNIRTATIYPAAINTELLETITDKETEQGMTSLYKQYGITPDRIASIVADHII_HUMAN CORTICOSTEROID 11-BETA-DEHYDROGENASE (EC 1.1.1.146) (11-DH) (11-BETA- HYDROXYSTEROID DEHYDROGENASE) (11-BETA-HSD) LENGTH = 292 COMBINED P-VALUE = 3.04e-26 E-VALUE = 1e-24 DIAGRAM: 32_[2]_125_[1]_88 [2] 1.1e-19 QGKVVLITGCSSGIGKATAKHFHKE +++ +++++++++++++++++++++1 MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVV [1] 6.1e-14 YCASKFAVRGFTRSMAMEYAPY +++++++++++ ++ +++++ +151 TVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKFVT1_HUMAN no comment LENGTH = 332 COMBINED P-VALUE = 1.03e-25 E-VALUE = 3.4e-24 DIAGRAM: 30_[2]_130_[1]_125 [2] 7.5e-16 QGKVVLITGCSSGIGKATAKHFHKE
⌨️ 快捷键说明
复制代码
Ctrl + C
搜索代码
Ctrl + F
全屏模式
F11
切换主题
Ctrl + Shift + D
显示快捷键
?
增大字号
Ctrl + =
减小字号
Ctrl + -