mast.farntrans5.oops

来自「EM算法的改进」· OOPS 代码 · 共 276 行

OOPS
276 行
字号
********************************************************************************MAST - Motif Alignment and Search Tool********************************************************************************	MAST version 3.5.1 (Release date: 2006/02/01 02:08:55)	For further information on how to interpret these results or to get	a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE********************************************************************************	If you use this program in your research, please cite:	Timothy L. Bailey and Michael Gribskov,	"Combining evidence using p-values: application to sequence homology	searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS********************************************************************************	DATABASE /home/meme/TEST/tests/farntrans5.s (peptide)	Last updated on Tue Jan 31 18:16:52 2006	Database contains 5 sequences, 1900 residues	MOTIFS /home/meme/TEST/tests/meme.farntrans5.oops (peptide)	MOTIF WIDTH BEST POSSIBLE MATCH	----- ----- -------------------	  1    32   QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR	  2    22   CQDEETGGFSDKPGNMVDFYHT	PAIRWISE MOTIF CORRELATIONS:	MOTIF     1	----- -----	   2   0.46	No overly similar pairs (correlation > 0.60) found.	Random model letter frequencies (from non-redundant database):	A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 	L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 	W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES********************************************************************************	- Each of the following 5 sequences has E-value less than 10.	- The E-value of a sequence is the expected number of sequences	  in a random database of the same size that would match the motifs as	  well as the sequence does and is equal to the combined p-value of the	  sequence times the number of sequences in the database.	- The combined p-value of a sequence measures the strength of the	  match of the sequence to all the motifs and is calculated by	    o finding the score of the single best match of each motif	      to the sequence (best matches may overlap),	    o calculating the sequence p-value of each score,	    o forming the product of the p-values,	    o taking the p-value of the product.	- The sequence p-value of a score is defined as the	  probability of a random sequence of the same length containing	  some match with as good or better a score.	- The score for the match of a position in a sequence to a motif	  is computed by by summing the appropriate entry from each column of	  the position-dependent scoring matrix that represents the motif.	- Sequences shorter than one or more of the motifs are skipped.	- The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME                      DESCRIPTION                   E-VALUE  LENGTH-------------                      -----------                   -------- ------RATRABGERB                         Rat rab geranylgeranyl tr...    1.4e-48    331BET2_YEAST                         YPT1/SEC4 PROTEINS GERANY...    1.1e-47    325PFTB_RAT                           PROTEIN FARNESYLTRANSFERA...    3.1e-40    437RAM1_YEAST                         PROTEIN FARNESYLTRANSFERA...    3.9e-40    431CAL1_YEAST                         RAS PROTEINS GERANYLGERAN...    4.2e-33    376****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS********************************************************************************	- The ordering and spacing of all non-overlapping motif occurrences	  are shown for each high-scoring sequence listed in Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001.	- The POSITION p-value of a match is the probability of	  a single random subsequence of the length of the motif	  scoring at least as well as the observed match.	- For each sequence, all motif occurrences are shown unless there	  are overlaps.  In that case, a motif occurrence is shown only if its	  p-value is less than the product of the p-values of the other	  (lower-numbered) motif occurrences that it overlaps.	- The table also shows the E-value of each sequence.	- Spacers and motif occurences are indicated by	   o -d-    `d' residues separate the end of the preceding motif 		    occurrence and the start of the following motif occurrence	   o [n]  occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME                      E-VALUE   MOTIF DIAGRAM-------------                      --------  -------------RATRABGERB                          1.4e-48  126_[1]_16_[1]_16_[1]_15_[2]_40BET2_YEAST                          1.1e-47  66_[2]_31_[1]_16_[1]_19_[1]_15_                                             [2]_38PFTB_RAT                            3.1e-40  133_[1]_19_[1]_16_[1]_17_[1]_                                             28_[2]_74RAM1_YEAST                          3.9e-40  291_[1]_19_[2]_67CAL1_YEAST                          4.2e-33  270_[1]_18_[2]_34****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES********************************************************************************	- The positions and p-values of the non-overlapping motif occurrences	  are shown above the actual sequence for each of the high-scoring	  sequences from Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001 as 	  defined in Section II.	- For each sequence, the first line specifies the name of the sequence.	- The second (and possibly more) lines give a description of the 	  sequence.	- Following the description line(s) is a line giving the length, 	  combined p-value, and E-value of the sequence as defined in Section I.	- The next line reproduces the motif diagram from Section II.	- The entire sequence is printed on the following lines.	- Motif occurrences are indicated directly above their positions in the	  sequence on lines showing	   o the motif number of the occurrence,	   o the position p-value of the occurrence,	   o the best possible match to the motif, and	   o columns whose match to the motif has a positive score (indicated 	     by a plus sign).********************************************************************************RATRABGERB  Rat rab geranylgeranyl transferase beta-subunit  LENGTH = 331  COMBINED P-VALUE = 2.87e-49  E-VALUE =  1.4e-48  DIAGRAM: 126_[1]_16_[1]_16_[1]_15_[2]_40                                                        [1]                                                        2.1e-09                                                        QQPEGGFNGRPNKLPDVCYSWWVL                                                        +++++ + +      ++  ++76   KSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAV                             [1]                                             [1]                             5.2e-06                                         7.6     GSLPIIGR                QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR                QQP     ++++++++                + +++++  ++         + + + +++                   +++151  ATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLP                                                 [2]     e-33                                        3.5e-24     EGGFNGRPNKLPDVCYSWWVLGSLPIIGR               CQDEETGGFSDKPGNMVDFYHT     +++++++++++++++++++++++++++++               ++++++++++++++++++++++226  SGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLBET2_YEAST  YPT1/SEC4 PROTEINS GERANYLGERANYLTRANSFERASE BETA SUBUNIT (EC 2.  LENGTH = 325  COMBINED P-VALUE = 2.19e-48  E-VALUE =  1.1e-47  DIAGRAM: 66_[2]_31_[1]_16_[1]_19_[1]_15_[2]_38                                                                       [2]                                                                       1.9e-05                                                                       CQDEETGGF                                                                       + + + + +1    MSGSLTLLKEKHIRYIESLDTNKHNFEYWLTEHLRLNGIYWGLTALCVLDSPETFVKEEVISFVLSCWDDKYGAF                                                 [1]                                                 4.3e-09     SDKPGNMVDFYHT                               QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIG     +  +  ++ +  +                               +++++ +++     +++   +  ++ + +++76   APFPRHDAHLLTTLSAVQILATYDALDVLGKDRKVRLISFIRGNQLEDGSFQGDRFGEVDTRFVYTALSALSILG                      [1]                                                [1]                      7.8e-08                                            3.5e-34     R                QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR                   QQPEGGF                        +++++   ++       ++ +++ +++ ++                   +++++++151  ELTSEVVDPAVDFVLKCYNFDGGFGLCPNAESHAAQAFTCLGALAIANKLDMLSDDQLEEIGWWLCERQLPEGGL                                             [2]                                             6.0e-22     NGRPNKLPDVCYSWWVLGSLPIIGR               CQDEETGGFSDKPGNMVDFYHT     +++++++++++++++++++++++++               ++++++++++++++++++++++226  NGRPSKLPDVCYSWWVLSSLAIIGRLDWINYEKLTEFILKCQDEKKGGISDRPENEVDVFHTVFGVAGLSLMGYDPFTB_RAT  PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT (EC 2.5.1.-) (CAAX FARNES  LENGTH = 437  COMBINED P-VALUE = 6.27e-41  E-VALUE =  3.1e-40  DIAGRAM: 133_[1]_19_[1]_16_[1]_17_[1]_28_[2]_74                                                               [1]                                                               5.4e-09                                                               QQPEGGFNGRPNKLPDV                                                               +++++++ + +   +76   EKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHL                                       [1]                                       5.8e-05     CYSWWVLGSLPIIGR                   QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR       ++   + + +++                     ++++ +       +++  ++  ++ + + +151  APTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGT            [1]                                              [1]            4.3e-09                                          1.9e-29            QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR                 QQPEGGFNGRPNKLPDVCY            +  +++  + +   + + +++  ++ + ++ +                 +++++++++++++++++++226  AEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY                                              [2]                                              2.0e-19     SWWVLGSLPIIGR                            CQDEETGGFSDKPGNMVDFYHT     ++++++ ++++++                            + +++++++ ++++++++++++301  SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHRAM1_YEAST  PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT (EC 2.5.1.-) (CAAX FARN  LENGTH = 431  COMBINED P-VALUE = 7.79e-41  E-VALUE =  3.9e-40  DIAGRAM: 291_[1]_19_[2]_67                                                                       [1]                                                                       2.8e-27                                                                       QQPEGGFNG                                                                        ++++++++226  LTEELTEGVLNYLKNCQNYEGGFGSCPHVDEAHGGYTFCATASLAILRSMDQINVEKLLEWSSARQLQEERGFCG                                               [2]                                               1.7e-21     RPNKLPDVCYSWWVLGSLPIIGR                   CQDEETGGFSDKPGNMVDFYHT     ++++++++++++++++++++++                    ++++++++++++++++++++++301  RSNKLVDGCYSFWVGGSAAILEAFGYGQCFNKHALRDYILYCCQEKEQPGLRDKPGAHSDFYHTNYCLLGLAVAECAL1_YEAST  RAS PROTEINS GERANYLGERANYLTRANSFERASE (EC 2.5.1.-) (PROTEIN GER  LENGTH = 376  COMBINED P-VALUE = 8.44e-34  E-VALUE =  4.2e-33  DIAGRAM: 270_[1]_18_[2]_34                                                  [1]                                                  2.8e-27                                                  QQPEGGFNGRPNKLPDVCYSWWVLGSLPII                                                  ++++++++++++++++++++++++++++++226  TLALLSSLEKLSDKFKEDTITWLLHRQVSSHGCMKFESELNASYDQSDDGGFQGRENKFADTCYAFWCLNSLHLL                         [2]                         3.0e-14     GR                  CQDEETGGFSDKPGNMVDFYHT     ++                   +++ +++++ +++++++++++301  TKDWKMLCQTELVTNYLLDRTQKTLTGGFSKNDEEDADLYHSCLGSAALALIEGKFNGELCIPQEIFNDFSKRCC********************************************************************************CPU: rocks-155.sdsc.eduTime 0.013997 secs.mast meme.farntrans5.oops

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?