📄 mast.farntrans5.oops
字号:
********************************************************************************MAST - Motif Alignment and Search Tool******************************************************************************** MAST version 3.5.1 (Release date: 2006/02/01 02:08:55) For further information on how to interpret these results or to get a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE******************************************************************************** If you use this program in your research, please cite: Timothy L. Bailey and Michael Gribskov, "Combining evidence using p-values: application to sequence homology searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS******************************************************************************** DATABASE /home/meme/TEST/tests/farntrans5.s (peptide) Last updated on Tue Jan 31 18:16:52 2006 Database contains 5 sequences, 1900 residues MOTIFS /home/meme/TEST/tests/meme.farntrans5.oops (peptide) MOTIF WIDTH BEST POSSIBLE MATCH ----- ----- ------------------- 1 32 QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR 2 22 CQDEETGGFSDKPGNMVDFYHT PAIRWISE MOTIF CORRELATIONS: MOTIF 1 ----- ----- 2 0.46 No overly similar pairs (correlation > 0.60) found. Random model letter frequencies (from non-redundant database): A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES******************************************************************************** - Each of the following 5 sequences has E-value less than 10. - The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database. - The combined p-value of a sequence measures the strength of the match of the sequence to all the motifs and is calculated by o finding the score of the single best match of each motif to the sequence (best matches may overlap), o calculating the sequence p-value of each score, o forming the product of the p-values, o taking the p-value of the product. - The sequence p-value of a score is defined as the probability of a random sequence of the same length containing some match with as good or better a score. - The score for the match of a position in a sequence to a motif is computed by by summing the appropriate entry from each column of the position-dependent scoring matrix that represents the motif. - Sequences shorter than one or more of the motifs are skipped. - The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME DESCRIPTION E-VALUE LENGTH------------- ----------- -------- ------RATRABGERB Rat rab geranylgeranyl tr... 1.4e-48 331BET2_YEAST YPT1/SEC4 PROTEINS GERANY... 1.1e-47 325PFTB_RAT PROTEIN FARNESYLTRANSFERA... 3.1e-40 437RAM1_YEAST PROTEIN FARNESYLTRANSFERA... 3.9e-40 431CAL1_YEAST RAS PROTEINS GERANYLGERAN... 4.2e-33 376****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS******************************************************************************** - The ordering and spacing of all non-overlapping motif occurrences are shown for each high-scoring sequence listed in Section I. - A motif occurrence is defined as a position in the sequence whose match to the motif has POSITION p-value less than 0.0001. - The POSITION p-value of a match is the probability of a single random subsequence of the length of the motif scoring at least as well as the observed match. - For each sequence, all motif occurrences are shown unless there are overlaps. In that case, a motif occurrence is shown only if its p-value is less than the product of the p-values of the other (lower-numbered) motif occurrences that it overlaps. - The table also shows the E-value of each sequence. - Spacers and motif occurences are indicated by o -d- `d' residues separate the end of the preceding motif occurrence and the start of the following motif occurrence o [n] occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME E-VALUE MOTIF DIAGRAM------------- -------- -------------RATRABGERB 1.4e-48 126_[1]_16_[1]_16_[1]_15_[2]_40BET2_YEAST 1.1e-47 66_[2]_31_[1]_16_[1]_19_[1]_15_ [2]_38PFTB_RAT 3.1e-40 133_[1]_19_[1]_16_[1]_17_[1]_ 28_[2]_74RAM1_YEAST 3.9e-40 291_[1]_19_[2]_67CAL1_YEAST 4.2e-33 270_[1]_18_[2]_34****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES******************************************************************************** - The positions and p-values of the non-overlapping motif occurrences are shown above the actual sequence for each of the high-scoring sequences from Section I. - A motif occurrence is defined as a position in the sequence whose match to the motif has POSITION p-value less than 0.0001 as defined in Section II. - For each sequence, the first line specifies the name of the sequence. - The second (and possibly more) lines give a description of the sequence. - Following the description line(s) is a line giving the length, combined p-value, and E-value of the sequence as defined in Section I. - The next line reproduces the motif diagram from Section II. - The entire sequence is printed on the following lines. - Motif occurrences are indicated directly above their positions in the sequence on lines showing o the motif number of the occurrence, o the position p-value of the occurrence, o the best possible match to the motif, and o columns whose match to the motif has a positive score (indicated by a plus sign).********************************************************************************RATRABGERB Rat rab geranylgeranyl transferase beta-subunit LENGTH = 331 COMBINED P-VALUE = 2.87e-49 E-VALUE = 1.4e-48 DIAGRAM: 126_[1]_16_[1]_16_[1]_15_[2]_40 [1] 2.1e-09 QQPEGGFNGRPNKLPDVCYSWWVL +++++ + + ++ ++76 KSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAV [1] [1] 5.2e-06 7.6 GSLPIIGR QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR QQP ++++++++ + +++++ ++ + + + +++ +++151 ATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLP [2] e-33 3.5e-24 EGGFNGRPNKLPDVCYSWWVLGSLPIIGR CQDEETGGFSDKPGNMVDFYHT +++++++++++++++++++++++++++++ ++++++++++++++++++++++226 SGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLBET2_YEAST YPT1/SEC4 PROTEINS GERANYLGERANYLTRANSFERASE BETA SUBUNIT (EC 2. LENGTH = 325 COMBINED P-VALUE = 2.19e-48 E-VALUE = 1.1e-47 DIAGRAM: 66_[2]_31_[1]_16_[1]_19_[1]_15_[2]_38 [2] 1.9e-05 CQDEETGGF + + + + +1 MSGSLTLLKEKHIRYIESLDTNKHNFEYWLTEHLRLNGIYWGLTALCVLDSPETFVKEEVISFVLSCWDDKYGAF [1] 4.3e-09 SDKPGNMVDFYHT QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIG + + ++ + + +++++ +++ +++ + ++ + +++76 APFPRHDAHLLTTLSAVQILATYDALDVLGKDRKVRLISFIRGNQLEDGSFQGDRFGEVDTRFVYTALSALSILG [1] [1] 7.8e-08 3.5e-34 R QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR QQPEGGF +++++ ++ ++ +++ +++ ++ +++++++151 ELTSEVVDPAVDFVLKCYNFDGGFGLCPNAESHAAQAFTCLGALAIANKLDMLSDDQLEEIGWWLCERQLPEGGL [2] 6.0e-22 NGRPNKLPDVCYSWWVLGSLPIIGR CQDEETGGFSDKPGNMVDFYHT +++++++++++++++++++++++++ ++++++++++++++++++++++226 NGRPSKLPDVCYSWWVLSSLAIIGRLDWINYEKLTEFILKCQDEKKGGISDRPENEVDVFHTVFGVAGLSLMGYDPFTB_RAT PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT (EC 2.5.1.-) (CAAX FARNES LENGTH = 437 COMBINED P-VALUE = 6.27e-41 E-VALUE = 3.1e-40 DIAGRAM: 133_[1]_19_[1]_16_[1]_17_[1]_28_[2]_74 [1] 5.4e-09 QQPEGGFNGRPNKLPDV +++++++ + + +76 EKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHL [1] 5.8e-05 CYSWWVLGSLPIIGR QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR ++ + + +++ ++++ + +++ ++ ++ + + +151 APTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGT [1] [1] 4.3e-09 1.9e-29 QQPEGGFNGRPNKLPDVCYSWWVLGSLPIIGR QQPEGGFNGRPNKLPDVCY + +++ + + + + +++ ++ + ++ + +++++++++++++++++++226 AEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY [2] 2.0e-19 SWWVLGSLPIIGR CQDEETGGFSDKPGNMVDFYHT ++++++ ++++++ + +++++++ ++++++++++++301 SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHRAM1_YEAST PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT (EC 2.5.1.-) (CAAX FARN LENGTH = 431 COMBINED P-VALUE = 7.79e-41 E-VALUE = 3.9e-40 DIAGRAM: 291_[1]_19_[2]_67 [1] 2.8e-27 QQPEGGFNG ++++++++226 LTEELTEGVLNYLKNCQNYEGGFGSCPHVDEAHGGYTFCATASLAILRSMDQINVEKLLEWSSARQLQEERGFCG [2] 1.7e-21 RPNKLPDVCYSWWVLGSLPIIGR CQDEETGGFSDKPGNMVDFYHT ++++++++++++++++++++++ ++++++++++++++++++++++301 RSNKLVDGCYSFWVGGSAAILEAFGYGQCFNKHALRDYILYCCQEKEQPGLRDKPGAHSDFYHTNYCLLGLAVAECAL1_YEAST RAS PROTEINS GERANYLGERANYLTRANSFERASE (EC 2.5.1.-) (PROTEIN GER LENGTH = 376 COMBINED P-VALUE = 8.44e-34 E-VALUE = 4.2e-33 DIAGRAM: 270_[1]_18_[2]_34 [1] 2.8e-27 QQPEGGFNGRPNKLPDVCYSWWVLGSLPII ++++++++++++++++++++++++++++++226 TLALLSSLEKLSDKFKEDTITWLLHRQVSSHGCMKFESELNASYDQSDDGGFQGRENKFADTCYAFWCLNSLHLL [2] 3.0e-14 GR CQDEETGGFSDKPGNMVDFYHT ++ +++ +++++ +++++++++++301 TKDWKMLCQTELVTNYLLDRTQKTLTGGFSKNDEEDADLYHSCLGSAALALIEGKFNGELCIPQEIFNDFSKRCC********************************************************************************CPU: rocks-155.sdsc.eduTime 0.013997 secs.mast meme.farntrans5.oops
⌨️ 快捷键说明
复制代码
Ctrl + C
搜索代码
Ctrl + F
全屏模式
F11
切换主题
Ctrl + Shift + D
显示快捷键
?
增大字号
Ctrl + =
减小字号
Ctrl + -