mast.adh.oops

来自「EM算法的改进」· OOPS 代码 · 共 886 行 · 第 1/3 页

OOPS
886 行
字号
********************************************************************************MAST - Motif Alignment and Search Tool********************************************************************************	MAST version 3.5.1 (Release date: 2006/02/01 02:08:55)	For further information on how to interpret these results or to get	a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE********************************************************************************	If you use this program in your research, please cite:	Timothy L. Bailey and Michael Gribskov,	"Combining evidence using p-values: application to sequence homology	searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS********************************************************************************	DATABASE /home/meme/TEST/tests/adh.s (peptide)	Last updated on Tue Jan 31 18:16:52 2006	Database contains 33 sequences, 9996 residues	MOTIFS /home/meme/TEST/tests/meme.adh.oops (peptide)	MOTIF WIDTH BEST POSSIBLE MATCH	----- ----- -------------------	  1    29   YSASKFAVRMLTRSMAHEYAPHGIRVNCI	  2    29   KVVLITGCSSGIGKATAKHLHKEGAKVVL	PAIRWISE MOTIF CORRELATIONS:	MOTIF     1	----- -----	   2   0.30	No overly similar pairs (correlation > 0.60) found.	Random model letter frequencies (from non-redundant database):	A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 	L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 	W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES********************************************************************************	- Each of the following 33 sequences has E-value less than 10.	- The E-value of a sequence is the expected number of sequences	  in a random database of the same size that would match the motifs as	  well as the sequence does and is equal to the combined p-value of the	  sequence times the number of sequences in the database.	- The combined p-value of a sequence measures the strength of the	  match of the sequence to all the motifs and is calculated by	    o finding the score of the single best match of each motif	      to the sequence (best matches may overlap),	    o calculating the sequence p-value of each score,	    o forming the product of the p-values,	    o taking the p-value of the product.	- The sequence p-value of a score is defined as the	  probability of a random sequence of the same length containing	  some match with as good or better a score.	- The score for the match of a position in a sequence to a motif	  is computed by by summing the appropriate entry from each column of	  the position-dependent scoring matrix that represents the motif.	- Sequences shorter than one or more of the motifs are skipped.	- The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME                      DESCRIPTION                   E-VALUE  LENGTH-------------                      -----------                   -------- ------BUDC_KLETE                         ACETOIN(DIACETYL) REDUCTA...    2.6e-33    241YRTP_BACSU                         HYPOTHETICAL 25.3 KD PROT...    4.3e-33    238AP27_MOUSE                         ADIPOCYTE P27 PROTEIN (AP...    4.5e-33    244HDE_CANTR                          HYDRATASE-DEHYDROGENASE-E...    1.6e-32    906HDHA_ECOLI                         7-ALPHA-HYDROXYSTEROID DE...    4.9e-31    255DHII_HUMAN                         CORTICOSTEROID 11-BETA-DE...    8.2e-31    292FIXR_BRAJA                         FIXR PROTEIN                   2.6e-30    278DHGB_BACME                         GLUCOSE 1-DEHYDROGENASE B...    3.2e-30    262NODG_RHIME                         NODULATION PROTEIN G (HOS...    3.4e-29    245RIDH_KLEAE                         RIBITOL 2-DEHYDROGENASE (...    6.2e-29    249YINL_LISMO                         HYPOTHETICAL 26.8 KD PROT...    6.6e-29    248DHMA_FLAS1                         N-ACYLMANNOSAMINE 1-DEHYD...    1.2e-28    270HMTR_LEIMA                         no comment                     5.1e-28    2872BHD_STREX                         20-BETA-HYDROXYSTEROID DE...    5.9e-28    255ENTA_ECOLI                         2,3-DIHYDRO-2,3-DIHYDROXY...    4.8e-27    248DHB2_HUMAN                         no comment                     1.7e-26    387BDH_HUMAN                          D-BETA-HYDROXYBUTYRATE DE...    2.8e-26    343BA72_EUBSP                         7-ALPHA-HYDROXYSTEROID DE...    4.2e-26    249FVT1_HUMAN                         no comment                     8.9e-26    332GUTD_ECOLI                         SORBITOL-6-PHOSPHATE 2-DE...    5.1e-25    259DHB3_HUMAN                         no comment                     8.3e-25    3103BHD_COMTE                         3-BETA-HYDROXYSTEROID DEH...    1.4e-24    253LIGD_PSEPA                         C ALPHA-DEHYDROGENASE (EC...    8.1e-24    305DHES_HUMAN                         ESTRADIOL 17 BETA-DEHYDRO...    2.4e-22    327RFBB_NEIGO                         no comment                     3.2e-19    346BPHB_PSEPS                         BIPHENYL-CIS-DIOL DEHYDRO...      1e-18    275YURA_MYXXA                         no comment                     1.9e-18    258PCR_PEA                            no comment                     7.2e-18    399DHCA_HUMAN                         no comment                     1.1e-17    276ADH_DROME                          ALCOHOL DEHYDROGENASE (EC...    2.7e-14    255MAS1_AGRRA                         no comment                       3e-14    476FABI_ECOLI                         no comment                     9.7e-14    262CSGA_MYXXA                         no comment                     2.5e-12    166****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS********************************************************************************	- The ordering and spacing of all non-overlapping motif occurrences	  are shown for each high-scoring sequence listed in Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001.	- The POSITION p-value of a match is the probability of	  a single random subsequence of the length of the motif	  scoring at least as well as the observed match.	- For each sequence, all motif occurrences are shown unless there	  are overlaps.  In that case, a motif occurrence is shown only if its	  p-value is less than the product of the p-values of the other	  (lower-numbered) motif occurrences that it overlaps.	- The table also shows the E-value of each sequence.	- Spacers and motif occurences are indicated by	   o -d-    `d' residues separate the end of the preceding motif 		    occurrence and the start of the following motif occurrence	   o [n]  occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME                      E-VALUE   MOTIF DIAGRAM-------------                      --------  -------------BUDC_KLETE                          2.6e-33  2_[2]_120_[1]_61YRTP_BACSU                          4.3e-33  6_[2]_119_[1]_55AP27_MOUSE                          4.5e-33  7_[2]_112_[1]_67HDE_CANTR                           1.6e-32  8_[2]_125_[1]_131_[2]_115_[1]_411HDHA_ECOLI                          4.9e-31  11_[2]_74_[1]_15_[1]_68DHII_HUMAN                          8.2e-31  34_[2]_119_[1]_81FIXR_BRAJA                          2.6e-30  36_[2]_123_[1]_61DHGB_BACME                          3.2e-30  7_[2]_123_[1]_74NODG_RHIME                          3.4e-29  6_[2]_116_[1]_65RIDH_KLEAE                          6.2e-29  14_[2]_116_[1]_61YINL_LISMO                          6.6e-29  5_[2]_75_[2]_15_[1]_66DHMA_FLAS1                          1.2e-28  14_[2]_121_[1]_77HMTR_LEIMA                          5.1e-28  6_[2]_157_[1]_662BHD_STREX                          5.9e-28  6_[2]_116_[1]_75ENTA_ECOLI                          4.8e-27  5_[2]_109_[1]_76DHB2_HUMAN                          1.7e-26  82_[2]_120_[1]_127BDH_HUMAN                           2.8e-26  55_[2]_123_[1]_107BA72_EUBSP                          4.2e-26  6_[2]_121_[1]_64FVT1_HUMAN                          8.9e-26  32_[2]_124_[1]_118GUTD_ECOLI                          5.1e-25  2_[2]_122_[1]_77DHB3_HUMAN                          8.3e-25  48_[2]_120_[1]_843BHD_COMTE                          1.4e-24  6_[2]_115_[1]_74LIGD_PSEPA                          8.1e-24  6_[2]_121_[1]_120DHES_HUMAN                          2.4e-22  2_[2]_50_[2]_44_[1]_144RFBB_NEIGO                          3.2e-19  6_[2]_129_[1]_153BPHB_PSEPS                            1e-18  5_[2]_118_[1]_94YURA_MYXXA                          1.9e-18  65_[2]_22_[2]_14_[1]_70PCR_PEA                             7.2e-18  25_[1]_32_[2]_284DHCA_HUMAN                          1.1e-17  4_[2]_159_[1]_55ADH_DROME                           2.7e-14  6_[2]_116_[1]_75MAS1_AGRRA                            3e-14  245_[2]_74_[1]_14_[1]_56FABI_ECOLI                          9.7e-14  6_[2]_123_[1]_75CSGA_MYXXA                          2.5e-12  51_[2]_7_[1]_50****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES********************************************************************************	- The positions and p-values of the non-overlapping motif occurrences	  are shown above the actual sequence for each of the high-scoring	  sequences from Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001 as 	  defined in Section II.	- For each sequence, the first line specifies the name of the sequence.	- The second (and possibly more) lines give a description of the 	  sequence.	- Following the description line(s) is a line giving the length, 	  combined p-value, and E-value of the sequence as defined in Section I.	- The next line reproduces the motif diagram from Section II.	- The entire sequence is printed on the following lines.	- Motif occurrences are indicated directly above their positions in the	  sequence on lines showing	   o the motif number of the occurrence,	   o the position p-value of the occurrence,	   o the best possible match to the motif, and	   o columns whose match to the motif has a positive score (indicated 	     by a plus sign).********************************************************************************BUDC_KLETE  ACETOIN(DIACETYL) REDUCTASE (EC 1.1.1.5) (ACETOIN DEHYDROGENASE)  LENGTH = 241  COMBINED P-VALUE = 7.82e-35  E-VALUE =  2.6e-33  DIAGRAM: 2_[2]_120_[1]_61       [2]       7.9e-21       KVVLITGCSSGIGKATAKHLHKEGAKVVL       +++++++++++++++++++++++++ + +1    MQKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATATAVAAEINQAGGRAVAIKVDVSRRDQVFAAVEQARK      [1]      2.6e-21      YSASKFAVRMLTRSMAHEYAPHGIRVNCI      +++++++++++++++++++++ ++++++151  VYSSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKTPMWAEIDRQCRKRRANRWATARLNLPNASPLAACRSLKYRTP_BACSU  HYPOTHETICAL 25.3 KD PROTEIN IN RTP 5'REGION (ORF238)  LENGTH = 238  COMBINED P-VALUE = 1.31e-34  E-VALUE =  4.3e-33  DIAGRAM: 6_[2]_119_[1]_55           [2]           2.8e-19           KVVLITGCSSGIGKATAKHLHKEGAKVVL           ++++++++++++++++++++++++ ++ +1    MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFAAADVKDADQVNQAVA         [1]         1.3e-22         YSASKFAVRMLTRSMAHEYAPHGIRVNCI         ++++++++ ++++++++++++++++++++151  VTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPRAP27_MOUSE  ADIPOCYTE P27 PROTEIN (AP27)  LENGTH = 244  COMBINED P-VALUE = 1.37e-34  E-VALUE =  4.5e-33  DIAGRAM: 7_[2]_112_[1]_67            [2]            7.4e-20            KVVLITGCSSGIGKATAKHLHKEGAKVVL             +++++++++++++ ++++++++++++++1    MKLNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIG                                                                              [1                                                                              4.                                                                              YS                                                                              ++76   PVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYS     ]     8e-22     ASKFAVRMLTRSMAHEYAPHGIRVNCI     ++++++++++++++++++++ ++++++151  STKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDHDE_CANTR  HYDRATASE-DEHYDROGENASE-EPIMERASE (HDE)  LENGTH = 906  COMBINED P-VALUE = 4.94e-34  E-VALUE =  1.6e-32  DIAGRAM: 8_[2]_125_[1]_131_[2]_115_[1]_411             [2]             2.5e-19             KVVLITGCSSGIGKATAKHLHKEGAKVVL             ++++++++++++++ + +++++ ++++++1    MSPVDFKDKVVIITGAGGGLGKYYSLEFAKLGAKVVVNDLGGALNGQGGNSKAADVVVDEIVKNGGVAVADYNNV                 [1]                 2.8e-13                 YSASKFAVRMLTRSMAHEYAPHGIRVNCI                 + +++ ++ ++ ++++++ ++++++ +++151  PAGLYGNFGQANYASAKSALLGFAETLAKEGAKYNIKANAIAPLARSRMTESILPPPMLEKLGPEKVAPLVLYLS                           [2]                           1.5e-24                           KVVLITGCSSGIGKATAKHLHKEGAKVVL                           +++++++++ +++++++++++++++++++301  TNEARKLPANDASGAPTVSLKDKVVLITGAGAGLGKEYAKWFAKYGAKVVVNDFKDATKTVDEIKAAGGEAWPDQ                     [1]                     5.2e-18                     YSASKFAVRMLTRSMAHEYAPHGIRVNCI                     ++++++++ +++++++ + ++ +++++++451  NITSTSGIYGNFGQANYSSSKAGILGLSKTMAIEGAKNNIKVNIVAPHAETAMTLTIFREQDKNLYHADQVAPLLHDHA_ECOLI  7-ALPHA-HYDROXYSTEROID DEHYDROGENASE (EC 1.1.1.159) (HSDH)  LENGTH = 255  COMBINED P-VALUE = 1.49e-32  E-VALUE =  4.9e-31  DIAGRAM: 11_[2]_74_[1]_15_[1]_68                [2]                4.3e-21

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?