mast.adh.zoops

来自「EM算法的改进」· ZOOPS 代码 · 共 878 行 · 第 1/3 页

ZOOPS
878 行
字号
********************************************************************************MAST - Motif Alignment and Search Tool********************************************************************************	MAST version 3.5.1 (Release date: 2006/02/01 02:08:55)	For further information on how to interpret these results or to get	a copy of the MAST software please access http://meme.nbcr.net.****************************************************************************************************************************************************************REFERENCE********************************************************************************	If you use this program in your research, please cite:	Timothy L. Bailey and Michael Gribskov,	"Combining evidence using p-values: application to sequence homology	searches", Bioinformatics, 14(48-54), 1998.****************************************************************************************************************************************************************DATABASE AND MOTIFS********************************************************************************	DATABASE /home/meme/TEST/tests/adh.s (peptide)	Last updated on Tue Jan 31 18:16:52 2006	Database contains 33 sequences, 9996 residues	MOTIFS /home/meme/TEST/tests/meme.adh.zoops (peptide)	MOTIF WIDTH BEST POSSIBLE MATCH	----- ----- -------------------	  1    27   YSASKFAVRMLTRSMRREYAPHGIRVN	  2    25   QGKVVLITGCSSGIGKATAKHLHKE	PAIRWISE MOTIF CORRELATIONS:	MOTIF     1	----- -----	   2   0.27	No overly similar pairs (correlation > 0.60) found.	Random model letter frequencies (from non-redundant database):	A 0.073 C 0.018 D 0.052 E 0.062 F 0.040 G 0.069 H 0.022 I 0.056 K 0.058 	L 0.092 M 0.023 N 0.046 P 0.051 Q 0.041 R 0.052 S 0.074 T 0.059 V 0.064 	W 0.013 Y 0.033 ****************************************************************************************************************************************************************SECTION I: HIGH-SCORING SEQUENCES********************************************************************************	- Each of the following 33 sequences has E-value less than 10.	- The E-value of a sequence is the expected number of sequences	  in a random database of the same size that would match the motifs as	  well as the sequence does and is equal to the combined p-value of the	  sequence times the number of sequences in the database.	- The combined p-value of a sequence measures the strength of the	  match of the sequence to all the motifs and is calculated by	    o finding the score of the single best match of each motif	      to the sequence (best matches may overlap),	    o calculating the sequence p-value of each score,	    o forming the product of the p-values,	    o taking the p-value of the product.	- The sequence p-value of a score is defined as the	  probability of a random sequence of the same length containing	  some match with as good or better a score.	- The score for the match of a position in a sequence to a motif	  is computed by by summing the appropriate entry from each column of	  the position-dependent scoring matrix that represents the motif.	- Sequences shorter than one or more of the motifs are skipped.	- The table is sorted by increasing E-value.********************************************************************************SEQUENCE NAME                      DESCRIPTION                   E-VALUE  LENGTH-------------                      -----------                   -------- ------YRTP_BACSU                         HYPOTHETICAL 25.3 KD PROT...    5.2e-34    238BUDC_KLETE                         ACETOIN(DIACETYL) REDUCTA...    7.4e-34    241AP27_MOUSE                         ADIPOCYTE P27 PROTEIN (AP...    3.7e-28    244FIXR_BRAJA                         FIXR PROTEIN                     2e-27    278DHII_HUMAN                         CORTICOSTEROID 11-BETA-DE...    9.7e-27    292DHGB_BACME                         GLUCOSE 1-DEHYDROGENASE B...      1e-26    262HDE_CANTR                          HYDRATASE-DEHYDROGENASE-E...    2.2e-26    906HDHA_ECOLI                         7-ALPHA-HYDROXYSTEROID DE...    2.3e-26    255NODG_RHIME                         NODULATION PROTEIN G (HOS...    6.1e-26    245YINL_LISMO                         HYPOTHETICAL 26.8 KD PROT...    1.2e-25    248RIDH_KLEAE                         RIBITOL 2-DEHYDROGENASE (...    6.7e-25    249HMTR_LEIMA                         no comment                     7.7e-25    287FVT1_HUMAN                         no comment                     1.8e-24    332DHMA_FLAS1                         N-ACYLMANNOSAMINE 1-DEHYD...    4.3e-24    270DHB2_HUMAN                         no comment                     5.7e-24    3873BHD_COMTE                         3-BETA-HYDROXYSTEROID DEH...    1.2e-23    253ENTA_ECOLI                         2,3-DIHYDRO-2,3-DIHYDROXY...    2.4e-23    248BA72_EUBSP                         7-ALPHA-HYDROXYSTEROID DE...    2.6e-23    2492BHD_STREX                         20-BETA-HYDROXYSTEROID DE...    3.7e-23    255BDH_HUMAN                          D-BETA-HYDROXYBUTYRATE DE...    7.5e-23    343DHES_HUMAN                         ESTRADIOL 17 BETA-DEHYDRO...    3.2e-22    327GUTD_ECOLI                         SORBITOL-6-PHOSPHATE 2-DE...    5.9e-22    259DHB3_HUMAN                         no comment                     7.5e-22    310BPHB_PSEPS                         BIPHENYL-CIS-DIOL DEHYDRO...    5.4e-20    275LIGD_PSEPA                         C ALPHA-DEHYDROGENASE (EC...    1.1e-19    305RFBB_NEIGO                         no comment                     1.1e-18    346DHCA_HUMAN                         no comment                       7e-17    276MAS1_AGRRA                         no comment                     8.5e-16    476PCR_PEA                            no comment                     1.3e-15    399ADH_DROME                          ALCOHOL DEHYDROGENASE (EC...    8.2e-15    255YURA_MYXXA                         no comment                     2.6e-12    258FABI_ECOLI                         no comment                       9e-10    262CSGA_MYXXA                         no comment                       6e-08    166****************************************************************************************************************************************************************SECTION II: MOTIF DIAGRAMS********************************************************************************	- The ordering and spacing of all non-overlapping motif occurrences	  are shown for each high-scoring sequence listed in Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001.	- The POSITION p-value of a match is the probability of	  a single random subsequence of the length of the motif	  scoring at least as well as the observed match.	- For each sequence, all motif occurrences are shown unless there	  are overlaps.  In that case, a motif occurrence is shown only if its	  p-value is less than the product of the p-values of the other	  (lower-numbered) motif occurrences that it overlaps.	- The table also shows the E-value of each sequence.	- Spacers and motif occurences are indicated by	   o -d-    `d' residues separate the end of the preceding motif 		    occurrence and the start of the following motif occurrence	   o [n]  occurrence of motif `n' with p-value less than 0.0001.********************************************************************************SEQUENCE NAME                      E-VALUE   MOTIF DIAGRAM-------------                      --------  -------------YRTP_BACSU                          5.2e-34  4_[2]_125_[1]_57BUDC_KLETE                          7.4e-34  [2]_33_[1]_66_[1]_63AP27_MOUSE                          3.7e-28  5_[2]_118_[1]_69FIXR_BRAJA                            2e-27  34_[2]_129_[1]_63DHII_HUMAN                          9.7e-27  32_[2]_125_[1]_83DHGB_BACME                            1e-26  5_[2]_129_[1]_76HDE_CANTR                           2.2e-26  6_[2]_131_[1]_131_[2]_121_[1]_                                             235_[2]_153HDHA_ECOLI                          2.3e-26  9_[2]_80_[1]_17_[1]_70NODG_RHIME                          6.1e-26  4_[2]_122_[1]_67YINL_LISMO                          1.2e-25  3_[2]_125_[1]_68RIDH_KLEAE                          6.7e-25  12_[2]_122_[1]_63HMTR_LEIMA                          7.7e-25  4_[2]_163_[1]_68FVT1_HUMAN                          1.8e-24  30_[2]_130_[1]_120DHMA_FLAS1                          4.3e-24  12_[2]_127_[1]_79DHB2_HUMAN                          5.7e-24  80_[2]_126_[1]_1293BHD_COMTE                          1.2e-23  4_[2]_30_[1]_64_[1]_76ENTA_ECOLI                          2.4e-23  3_[2]_115_[1]_78BA72_EUBSP                          2.6e-23  4_[2]_35_[1]_65_[1]_662BHD_STREX                          3.7e-23  4_[2]_122_[1]_77BDH_HUMAN                           7.5e-23  53_[2]_129_[1]_109DHES_HUMAN                          3.2e-22  [2]_129_[1]_146GUTD_ECOLI                          5.9e-22  [2]_128_[1]_79DHB3_HUMAN                          7.5e-22  46_[2]_126_[1]_86BPHB_PSEPS                          5.4e-20  3_[2]_124_[1]_96LIGD_PSEPA                          1.1e-19  4_[2]_127_[1]_122RFBB_NEIGO                          1.1e-18  4_[2]_135_[1]_155DHCA_HUMAN                            7e-17  2_[2]_34_[1]_104_[1]_57MAS1_AGRRA                          8.5e-16  243_[2]_123_[1]_58PCR_PEA                             1.3e-15  84_[2]_34_[1]_229ADH_DROME                           8.2e-15  4_[2]_122_[1]_77YURA_MYXXA                          2.6e-12  159_[1]_72FABI_ECOLI                            9e-10  4_[2]_129_[1]_77CSGA_MYXXA                            6e-08  87_[1]_52****************************************************************************************************************************************************************SECTION III: ANNOTATED SEQUENCES********************************************************************************	- The positions and p-values of the non-overlapping motif occurrences	  are shown above the actual sequence for each of the high-scoring	  sequences from Section I.	- A motif occurrence is defined as a position in the sequence whose	  match to the motif has POSITION p-value less than 0.0001 as 	  defined in Section II.	- For each sequence, the first line specifies the name of the sequence.	- The second (and possibly more) lines give a description of the 	  sequence.	- Following the description line(s) is a line giving the length, 	  combined p-value, and E-value of the sequence as defined in Section I.	- The next line reproduces the motif diagram from Section II.	- The entire sequence is printed on the following lines.	- Motif occurrences are indicated directly above their positions in the	  sequence on lines showing	   o the motif number of the occurrence,	   o the position p-value of the occurrence,	   o the best possible match to the motif, and	   o columns whose match to the motif has a positive score (indicated 	     by a plus sign).********************************************************************************YRTP_BACSU  HYPOTHETICAL 25.3 KD PROTEIN IN RTP 5'REGION (ORF238)  LENGTH = 238  COMBINED P-VALUE = 1.57e-35  E-VALUE =  5.2e-34  DIAGRAM: 4_[2]_125_[1]_57         [2]         2.0e-20         QGKVVLITGCSSGIGKATAKHLHKE         +++ +++++++++++++++++++++1    MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFAAADVKDADQVNQAVA         [1]         2.0e-22         YSASKFAVRMLTRSMRREYAPHGIRVN         ++++++++ ++++++++++++++++++151  VTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPRBUDC_KLETE  ACETOIN(DIACETYL) REDUCTASE (EC 1.1.1.5) (ACETOIN DEHYDROGENASE)  LENGTH = 241  COMBINED P-VALUE = 2.24e-35  E-VALUE =  7.4e-34  DIAGRAM: [2]_33_[1]_66_[1]_63     [2]                                                       [1]     1.5e-20                                                   7.7e-05     QGKVVLITGCSSGIGKATAKHLHKE                                 YSASKFAVRMLTRSMRR     +++++++++++++++++++++++++                                   +    + + ++ +++1    MQKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATATAVAAEINQAGGRAVAIKVDVSRRDQVFAAVEQARK               EYAPHGIRVN      ++  ++ ++76   ALGGFNVIVNNAGIAPSTPIESITEEIVDRVYNINVKGVIWGMQAAVEAFKKEGHGGKIVNACSQAGHVGNPELA      [1]      3.9e-22      YSASKFAVRMLTRSMRREYAPHGIRVN      +++++++++++++++++++++++++++151  VYSSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKTPMWAEIDRQCRKRRANRWATARLNLPNASPLAACRSLKAP27_MOUSE  ADIPOCYTE P27 PROTEIN (AP27)  LENGTH = 244  COMBINED P-VALUE = 1.14e-29  E-VALUE =  3.7e-28  DIAGRAM: 5_[2]_118_[1]_69          [2]          7.6e-16          QGKVVLITGCSSGIGKATAKHLHKE          ++  ++++++++++++ ++++++++1    MKLNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIG                                                                              [1                                                                              4.                                                                              YS                                                                              ++76   PVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYS     ]     3e-21     ASKFAVRMLTRSMRREYAPHGIRVN     ++++++++++++++++++++ ++++151  STKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDFIXR_BRAJA  FIXR PROTEIN  LENGTH = 278  COMBINED P-VALUE = 6.20e-29  E-VALUE =    2e-27  DIAGRAM: 34_[2]_129_[1]_63                                       [2]                                       1.7e-16                                       QGKVVLITGCSSGIGKATAKHLHKE                                       + ++++ +++++++++++++ + ++1    MGLDLPNDNLIRGPLPEAHLDRLVDAVNARVDRGEPKVMLLTGASRGIGHATAKLFSEAGWRIISCARQPFDGER                                           [1]                                           8.0e-20                                           YSASKFAVRMLTRSMRREYAPHGIRVN                                           +  +++++ ++++++++++++++++++151  APILLAQGLFDELRAASGSIVNVTSIAGSRVHPFAGSAYATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDDHII_HUMAN  CORTICOSTEROID 11-BETA-DEHYDROGENASE (EC 1.1.1.146) (11-DH) (11-BETA-   HYDROXYSTEROID DEHYDROGENASE) (11-BETA-HSD)  LENGTH = 292  COMBINED P-VALUE = 2.94e-28  E-VALUE =  9.7e-27  DIAGRAM: 32_[2]_125_[1]_83                                     [2]                                     7.5e-20                                     QGKVVLITGCSSGIGKATAKHLHKE

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?