tmap.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 302 行

TXT
302
字号
                                   tmap Function   Displays membrane spanning regionsDescription   This program predicts transmembrane segments in proteins, utilising   the algorithm described in: "Persson, B. & Argos, P. (1994) Prediction   of transmembrane segments in proteins utilising multiple sequence   alignments J. Mol. Biol. 237, 182-192."   tmap reads in one or more aligned protein sequences.   Two sets of propensity values are then used for the calculations: one   for the middle, hydrophobic portion and one for the terminal regions   of the transmembrane sequence spans. Average propensity values are   calculated for each position along the alignment, with the   contribution from each sequence weighted according to its   dissimilarity relative to the other aligned sequences.   Eight-residue segments are considered as potential cores of   transmembrane segments and elongated if thier middle propensity values   are above a threshold. End propensity values are also considered as   stop signals. Only helices with a length of 15 to 29 residues are   allowed and corrections for strictly conserved charged residues are   made.   The method is more successful than predictions based upon single   sequences alone.   The results are plotted on a graph and written to a text file.Usage   Here is a sample session with tmap% tmap opsd.msf -out tmap.res -graph cps Displays membrane spanning regionsCreated tmap.ps   Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequences]         seqset     File containing a sequence alignment   -graph              xygraph    [$EMBOSS_GRAPHICS value, or x11] Graph type                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,                                  tekt, tek, none, data, xterm, png)  [-outfile]           report     [*.tmap] Output report file name   Additional (Optional) qualifiers: (none)   Advanced (Unprompted) qualifiers: (none)   Associated qualifiers:   "-sequences" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-graph" associated qualifiers   -gprompt            boolean    Graph prompting   -gdesc              string     Graph description   -gtitle             string     Graph title   -gsubtitle          string     Graph subtitle   -gxtitle            string     Graph x axis title   -gytitle            string     Graph y axis title   -goutfile           string     Output file for non interactive displays   -gdirectory         string     Output directory   "-outfile" associated qualifiers   -rformat2           string     Report format   -rname2             string     Base file name   -rextension2        string     File name extension   -rdirectory2        string     Output directory   -raccshow2          boolean    Show accession number in the report   -rdesshow2          boolean    Show description in the report   -rscoreshow2        boolean    Show the score in the report   -rusashow2          boolean    Show the full USA in the report   -rmaxall2           integer    Maximum total hits to report   -rmaxseq2           integer    Maximum hits to report for one sequence   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   tmap reads a protein sequence USA for one or more aligned sequences.  Input files for usage example  File: opsd.msf!!AA_MULTIPLE_ALIGNMENT 1.0  opsd.msf MSF:  354 Type: P 15/07/06 CompCheck: 5414 ..  Name: OPSD_HUMAN Len: 354  Check: 2647 Weight: 50.00  Name: OPSD_XENLA Len: 354  Check: 2767 Weight: 50.00//           1                                               50OPSD_HUMAN MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLOPSD_XENLA MNGTEGPNFYVPMSNKTGVVRSPFDYPQYYLAEPWQYSALAAYMFLLILL           51                                             100OPSD_HUMAN GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHOPSD_XENLA GLPINFMTLFVTIQHKKLRTPLNYILLNLVFANHFMVLCGFTVTMYTSMH           101                                            150OPSD_HUMAN GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGEOPSD_XENLA GYFIFGPTGCYIEGFFATLGGEVALWSLVVLAVERYIVVCKPMANFRFGE           151                                            200OPSD_HUMAN NHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNOPSD_XENLA NHAIMGVAFTWIMALSCAAPPLFGWSRYIPEGMQCSCGVDYYTLKPEVNN           201                                            250OPSD_HUMAN ESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVOPSD_XENLA ESFVIYMFIVHFTIPLIVIFFCYGRLLCTVKEAAAQQQESLTTQKAEKEV           251                                            300OPSD_HUMAN TRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIOPSD_XENLA TRMVVIMVVFFLICWVPYAYVAFYIFTHQGSNFGPVFMTVPAFFAKSSAI           301                                            350OPSD_HUMAN YNPVIYIMMNKQFRNCMLTTICCGKNPLGD.DEASATVSKTETSQVAPA~OPSD_XENLA YNPVIYIVLNKQFRNCLITTLCCGKNPFGDEDGSSAATSKTEASSVSSSQ           351OPSD_HUMAN ~~~~OPSD_XENLA VSPAOutput file format  Output files for usage example  File: tmap.res######################################### Program: tmap# Rundate: Sat 15 Jul 2006 12:00:00# Commandline: tmap#    [-sequences] ../../data/opsd.msf#    -outfile tmap.res#    -graph cps# Report_format: seqtable# Report_file: tmap.res#########################################=======================================## Sequence: Consensus     from: 1   to: 354# HitCount: 7#=======================================  Start     End TransMem Sequence     43      70        1 YMFLLIvLGxPINFlTLyVTvQHKKLRT     71      98        2 PLNYILLNLxxAdxFMVLxGFTxTlYTS    112     140        3 lEGFFATLGGEiALWSLVVLAiERYvVVC    148     176        4 FGENHAIMGVAFTWvMALaCAAPPLxGWS    201     229        5 ESFVIYMFvVHFTIPmIiIFFCYGqLvxT    256     276        6 IMVixFLICWVPYAxVAFYIF    285     305        7 PiFMTiPAFFAKSaAIYNPVI#---------------------------------------#---------------------------------------#=======================================## Sequence: OPSD_HUMAN     from: 1   to: 354# HitCount: 7#=======================================  Start     End TransMem Sequence     43      70        1 YMFLLIVLGFPINFLTLYVTVQHKKLRT     71      98        2 PLNYILLNLAVADLFMVLGGFTSTLYTS    112     140        3 LEGFFATLGGEIALWSLVVLAIERYVVVC    148     176        4 FGENHAIMGVAFTWVMALACAAPPLAGWS    201     229        5 ESFVIYMFVVHFTIPMIIIFFCYGQLVFT    256     276        6 IMVIAFLICWVPYASVAFYIF    285     305        7 PIFMTIPAFFAKSAAIYNPVI#---------------------------------------#---------------------------------------#=======================================## Sequence: OPSD_XENLA     from: 1   to: 354# HitCount: 7#=======================================  Start     End TransMem Sequence     43      70        1 YMFLLILLGLPINFMTLFVTIQHKKLRT     71      98        2 PLNYILLNLVFANHFMVLCGFTVTMYTS    112     140        3 IEGFFATLGGEVALWSLVVLAVERYIVVC    148     176        4 FGENHAIMGVAFTWIMALSCAAPPLFGWS    201     229        5 ESFVIYMFIVHFTIPLIVIFFCYGRLLCT    256     276        6 IMVVFFLICWVPYAYVAFYIF    285     305        7 PVFMTVPAFFAKSSAIYNPVI#---------------------------------------#---------------------------------------#---------------------------------------# Total_sequences: 3# Total_hitcount: 21#---------------------------------------  Graphics File: tmap.ps   [tmap results]   A plot of the propensities to form the middle (solid line) and the end   (dashed line) of transmembrane regions is output.   Bars are displayed in the plot above the regions predicted as being   most likely to form transmembrane regions.   The text file (specified by the -outfile option) gives a summary of   these regions.   The transmembrane regions for the complete alignment are given first,   followed by the predictions for each individual sequence in the   alignment.Data files   None.Notes   None.References    1. "Persson, B. & Argos, P. (1994) Prediction of transmembrane       segments in proteins utilsing multiple sequence alignments J. Mol.       Biol. 237, 182-192."Warnings   None.Diagnostic Error Messages   None.Exit status   0 if successful.Known bugs   None.See also    Program name              Description   garnier        Predicts protein secondary structure   helixturnhelix Report nucleic acid binding motifs   hmoment        Hydrophobic moment calculation   pepcoil        Predicts coiled coil regions   pepnet         Displays proteins as a helical net   pepwheel       Shows protein sequences as helicesAuthor(s)   Original program by Bengt Persson and Patrick Argos.   This application was modified for inclusion in EMBOSS by Ian Longden   (il 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?