📄 tmap.txt
字号:
tmap Function Displays membrane spanning regionsDescription This program predicts transmembrane segments in proteins, utilising the algorithm described in: "Persson, B. & Argos, P. (1994) Prediction of transmembrane segments in proteins utilising multiple sequence alignments J. Mol. Biol. 237, 182-192." tmap reads in one or more aligned protein sequences. Two sets of propensity values are then used for the calculations: one for the middle, hydrophobic portion and one for the terminal regions of the transmembrane sequence spans. Average propensity values are calculated for each position along the alignment, with the contribution from each sequence weighted according to its dissimilarity relative to the other aligned sequences. Eight-residue segments are considered as potential cores of transmembrane segments and elongated if thier middle propensity values are above a threshold. End propensity values are also considered as stop signals. Only helices with a length of 15 to 29 residues are allowed and corrections for strictly conserved charged residues are made. The method is more successful than predictions based upon single sequences alone. The results are plotted on a graph and written to a text file.Usage Here is a sample session with tmap% tmap opsd.msf -out tmap.res -graph cps Displays membrane spanning regionsCreated tmap.ps Go to the input files for this example Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-sequences] seqset File containing a sequence alignment -graph xygraph [$EMBOSS_GRAPHICS value, or x11] Graph type (ps, hpgl, hp7470, hp7580, meta, cps, x11, tekt, tek, none, data, xterm, png) [-outfile] report [*.tmap] Output report file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-sequences" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-graph" associated qualifiers -gprompt boolean Graph prompting -gdesc string Graph description -gtitle string Graph title -gsubtitle string Graph subtitle -gxtitle string Graph x axis title -gytitle string Graph y axis title -goutfile string Output file for non interactive displays -gdirectory string Output directory "-outfile" associated qualifiers -rformat2 string Report format -rname2 string Base file name -rextension2 string File name extension -rdirectory2 string Output directory -raccshow2 boolean Show accession number in the report -rdesshow2 boolean Show description in the report -rscoreshow2 boolean Show the score in the report -rusashow2 boolean Show the full USA in the report -rmaxall2 integer Maximum total hits to report -rmaxseq2 integer Maximum hits to report for one sequence General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format tmap reads a protein sequence USA for one or more aligned sequences. Input files for usage example File: opsd.msf!!AA_MULTIPLE_ALIGNMENT 1.0 opsd.msf MSF: 354 Type: P 15/07/06 CompCheck: 5414 .. Name: OPSD_HUMAN Len: 354 Check: 2647 Weight: 50.00 Name: OPSD_XENLA Len: 354 Check: 2767 Weight: 50.00// 1 50OPSD_HUMAN MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLOPSD_XENLA MNGTEGPNFYVPMSNKTGVVRSPFDYPQYYLAEPWQYSALAAYMFLLILL 51 100OPSD_HUMAN GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHOPSD_XENLA GLPINFMTLFVTIQHKKLRTPLNYILLNLVFANHFMVLCGFTVTMYTSMH 101 150OPSD_HUMAN GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGEOPSD_XENLA GYFIFGPTGCYIEGFFATLGGEVALWSLVVLAVERYIVVCKPMANFRFGE 151 200OPSD_HUMAN NHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNOPSD_XENLA NHAIMGVAFTWIMALSCAAPPLFGWSRYIPEGMQCSCGVDYYTLKPEVNN 201 250OPSD_HUMAN ESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVOPSD_XENLA ESFVIYMFIVHFTIPLIVIFFCYGRLLCTVKEAAAQQQESLTTQKAEKEV 251 300OPSD_HUMAN TRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIOPSD_XENLA TRMVVIMVVFFLICWVPYAYVAFYIFTHQGSNFGPVFMTVPAFFAKSSAI 301 350OPSD_HUMAN YNPVIYIMMNKQFRNCMLTTICCGKNPLGD.DEASATVSKTETSQVAPA~OPSD_XENLA YNPVIYIVLNKQFRNCLITTLCCGKNPFGDEDGSSAATSKTEASSVSSSQ 351OPSD_HUMAN ~~~~OPSD_XENLA VSPAOutput file format Output files for usage example File: tmap.res######################################### Program: tmap# Rundate: Sat 15 Jul 2006 12:00:00# Commandline: tmap# [-sequences] ../../data/opsd.msf# -outfile tmap.res# -graph cps# Report_format: seqtable# Report_file: tmap.res#########################################=======================================## Sequence: Consensus from: 1 to: 354# HitCount: 7#======================================= Start End TransMem Sequence 43 70 1 YMFLLIvLGxPINFlTLyVTvQHKKLRT 71 98 2 PLNYILLNLxxAdxFMVLxGFTxTlYTS 112 140 3 lEGFFATLGGEiALWSLVVLAiERYvVVC 148 176 4 FGENHAIMGVAFTWvMALaCAAPPLxGWS 201 229 5 ESFVIYMFvVHFTIPmIiIFFCYGqLvxT 256 276 6 IMVixFLICWVPYAxVAFYIF 285 305 7 PiFMTiPAFFAKSaAIYNPVI#---------------------------------------#---------------------------------------#=======================================## Sequence: OPSD_HUMAN from: 1 to: 354# HitCount: 7#======================================= Start End TransMem Sequence 43 70 1 YMFLLIVLGFPINFLTLYVTVQHKKLRT 71 98 2 PLNYILLNLAVADLFMVLGGFTSTLYTS 112 140 3 LEGFFATLGGEIALWSLVVLAIERYVVVC 148 176 4 FGENHAIMGVAFTWVMALACAAPPLAGWS 201 229 5 ESFVIYMFVVHFTIPMIIIFFCYGQLVFT 256 276 6 IMVIAFLICWVPYASVAFYIF 285 305 7 PIFMTIPAFFAKSAAIYNPVI#---------------------------------------#---------------------------------------#=======================================## Sequence: OPSD_XENLA from: 1 to: 354# HitCount: 7#======================================= Start End TransMem Sequence 43 70 1 YMFLLILLGLPINFMTLFVTIQHKKLRT 71 98 2 PLNYILLNLVFANHFMVLCGFTVTMYTS 112 140 3 IEGFFATLGGEVALWSLVVLAVERYIVVC 148 176 4 FGENHAIMGVAFTWIMALSCAAPPLFGWS 201 229 5 ESFVIYMFIVHFTIPLIVIFFCYGRLLCT 256 276 6 IMVVFFLICWVPYAYVAFYIF 285 305 7 PVFMTVPAFFAKSSAIYNPVI#---------------------------------------#---------------------------------------#---------------------------------------# Total_sequences: 3# Total_hitcount: 21#--------------------------------------- Graphics File: tmap.ps [tmap results] A plot of the propensities to form the middle (solid line) and the end (dashed line) of transmembrane regions is output. Bars are displayed in the plot above the regions predicted as being most likely to form transmembrane regions. The text file (specified by the -outfile option) gives a summary of these regions. The transmembrane regions for the complete alignment are given first, followed by the predictions for each individual sequence in the alignment.Data files None.Notes None.References 1. "Persson, B. & Argos, P. (1994) Prediction of transmembrane segments in proteins utilsing multiple sequence alignments J. Mol. Biol. 237, 182-192."Warnings None.Diagnostic Error Messages None.Exit status 0 if successful.Known bugs None.See also Program name Description garnier Predicts protein secondary structure helixturnhelix Report nucleic acid binding motifs hmoment Hydrophobic moment calculation pepcoil Predicts coiled coil regions pepnet Displays proteins as a helical net pepwheel Shows protein sequences as helicesAuthor(s) Original program by Bengt Persson and Patrick Argos. This application was modified for inclusion in EMBOSS by Ian Longden (il
⌨️ 快捷键说明
复制代码
Ctrl + C
搜索代码
Ctrl + F
全屏模式
F11
切换主题
Ctrl + Shift + D
显示快捷键
?
增大字号
Ctrl + =
减小字号
Ctrl + -