biosed.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 326 行
TXT
326 行
biosed Function Replace or delete sequence sectionsDescription biosed is a simple sequence editing utility that searches for a target subsequence in one or more input sequences and replaces it with a specified second subsequence (or optionally just deletes the found target subsequence). biosed was inspired by the useful UNIX utility sed which searches for a pattern in text and can replace or delete the found pattern. If the target subsequence occurs more than once, then each instance of the target is replaced. The target subsequence is not any sort of an ambiguity pattern, it is just a short sequence. A simple string match is done and if it exactly matches then the replacement is done. The matching is independent of the case of the sequence or the target - both uppercase and lowercase will match.Usage Here is a sample session with biosed Replace all 'T's with 'U's to create an RNA sequence% biosed tembl:hsfau hsfau.rna -target T -replace U Replace or delete sequence sections Go to the input files for this example Go to the output files for this example Example 2 Replace all 'PPP' protein motifs with 'XXPPPXX'% biosed tsw:AMIR_PSEAE AMIR_PSEAE.pep -target PPP -replace XXPPPXX Replace or delete sequence sections Go to the input files for this example Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers (* if not always prompted): [-sequence] seqall (Gapped) sequence(s) filename and optional format, or reference (input USA) -target string [N] Sequence section to match (Any string is accepted)* -replace string [A] Replacement sequence section (Any string is accepted) [-outseq] seqout [.] Sequence filename and optional format (output USA) Additional (Optional) qualifiers: -position integer [0] Sequence position to match (Integer 0 or more) Advanced (Unprompted) qualifiers: -delete toggle [N] Delete the target sequence sections Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outseq" associated qualifiers -osformat2 string Output seq format -osextension2 string File name extension -osname2 string Base file name -osdirectory2 string Output directory -osdbname2 string Database name to add -ossingle2 boolean Separate file for each entry -oufo2 string UFO features -offormat2 string Features format -ofname2 string Features file name -ofdirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format It reads the USA of one or more nucleic acid or protein sequences. Input files for usage example 'tembl:hsfau' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:hsfauID HSFAU standard; RNA; HUM; 518 BP.XXAC X65923;XXSV X65923.1XXDT 13-MAY-1992 (Rel. 31, Created)DT 23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE H.sapiens fau mRNAXXKW fau gene.XXOS Homo sapiens (human)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN [1]RP 1-518RA Michiels L.M.R.;RT ;RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN [2]RP 1-518RX MEDLINE; 93368957.RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL Oncogene 8:2537-2546(1993).XXDR SWISS-PROT; P35544; UBIM_HUMAN.DR SWISS-PROT; Q05472; RS30_HUMAN.XXFH Key Location/QualifiersFHFT source 1..518FT /chromosome="11q"FT /db_xref="taxon:9606"FT /organism="Homo sapiens"FT /tissue_type="placenta"FT /clone_lib="cDNA"FT /clone="pUIA 631"FT /map="13"FT misc_feature 57..278FT /note="ubiquitin like part"FT CDS 57..458FT /db_xref="SWISS-PROT:P35544"FT /db_xref="SWISS-PROT:Q05472"FT /gene="fau"FT /protein_id="CAA46716.1"FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT misc_feature 98..102FT /note="nucleolar localization signal"FT misc_feature 279..458FT /note="S30 part"FT polyA_signal 484..489FT polyA_site 509XXSQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518// Input files for usage example 2 'tsw:AMIR_PSEAE' is a sequence entry in the example protein database 'tsw' Database entry: tsw:AMIR_PSEAEID AMIR_PSEAE STANDARD; PRT; 196 AA.AC P10932;DT 01-JUL-1989 (Rel. 11, Created)DT 01-JUL-1989 (Rel. 11, Last sequence update)DT 15-DEC-1998 (Rel. 37, Last annotation update)DE ALIPHATIC AMIDASE REGULATOR.GN AMIR.OS Pseudomonas aeruginosa.OC Bacteria; Proteobacteria; gamma subdivision; Pseudomonas group;OC Pseudomonas.RN [1]RP SEQUENCE FROM N.A.RC STRAIN=PAC;RX MEDLINE; 89211409.RA LOWE N., RICE P.M., DREW R.E.;RT "Nucleotide sequence of the aliphatic amidase regulator gene (amiR)RT of Pseudomonas aeruginosa.";RL FEBS Lett. 246:39-43(1989).RN [2]RP CHARACTERIZATION.RX MEDLINE; 95286483.RA WILSON S.A., DREW R.E.;RT "Transcriptional analysis of the amidase operon from PseudomonasRT aeruginosa.";RL J. Bacteriol. 177:3052-3057(1995).CC -!- FUNCTION: POSITIVE CONTROLLING ELEMENT OF AMIE, THE GENE FORCC ALIPHATIC AMIDASE. ACTS AS A TRANSCRIPTIONAL ANTITERMINATIONCC FACTOR. IT IS THOUGHT TO ALLOW RNA POLYMERASE READ THROUGH A RHO-CC INDEPENDENT TRANSCRIPTION TERMINATOR BETWEEN THE AMIE PROMOTER ANDCC GENE.CC --------------------------------------------------------------------------CC This SWISS-PROT entry is copyright. It is produced through a collaborationCC between the Swiss Institute of Bioinformatics and the EMBL outstation -CC the European Bioinformatics Institute. There are no restrictions on itsCC use by non-profit institutions as long as its content is in no wayCC modified and this statement is not removed. Usage by and for commercialCC entities requires a license agreement (See http://www.isb-sib.ch/announce/CC or send an email to license@isb-sib.ch).CC --------------------------------------------------------------------------DR EMBL; X13776; CAA32023.1; -.DR PIR; S03884; S03884.KW Transcription regulation; Activator.SQ SEQUENCE 196 AA; 21776 MW; 560A8AE3 CRC32; MSANSLLGSL RELQVLVLNP PGEVSDALVL QLIRIGCSVR QCWPPPEAFD VPVDVVFTSI FQNGHHDEIA ALLAAGTPRT TLVALVEYES PAVLSQIIEL ECHGVITQPL DAHRVLPVLV SARRISEEMA KLKQKTEQLQ DRIAGQARIN QAKVLLMQRH GWDEREAHQH LSREAMKRRE PILKIAQELL GNEPSA//Output file format The edited sequence is output. The sequence will be in uppercase. Output files for usage example File: hsfau.rna>HSFAU X65923.1 H.sapiens fau mRNAUUCCUCUUUCUCGACUCCAUCUUCGCGGUAGCUGGGACCGCCGUUCAGUCGCCAAUAUGCAGCUCUUUGUCCGCGCCCAGGAGCUACACACCUUCGAGGUGACCGGCCAGGAAACGGUCGCCCAGAUCAAGGCUCAUGUAGCCUCACUGGAGGGCAUUGCCCCGGAAGAUCAAGUCGUGCUCCUGGCAGGCGCGCCCCUGGAGGAUGAGGCCACUCUGGGCCAGUGCGGGGUGGAGGCCCUGACUACCCUGGAAGUAGCAGGCCGCAUGCUUGGAGGUAAAGUUCAUGGUUCCCUGGCCCGUGCUGGAAAAGUGAGAGGUCAGACUCCUAAGGUGGCCAAACAGGAGAAGAAGAAGAAGAAGACAGGUCGGGCUAAGCGGCGGAUGCAGUACAACCGGCGCUUUGUCAACGUUGUGCCCACCUUUGGCAAGAAGAAGGGCCCCAAUGCCAACUCUUAAGUCUUUUGUAAUUCUGGCUUUCUCUAAUAAAAAAGCCACUUAGUUCAGUCAAAAAAAAAA Output files for usage example 2 File: AMIR_PSEAE.pep>AMIR_PSEAE P10932 ALIPHATIC AMIDASE REGULATOR.MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWXXPPPXXEAFDVPVDVVFTSIFQNGHHDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSAData files None.Notes The edited sequence will be output in uppercase.References None.Warnings No check is made on the replacement subsequence. Any text can be used as the replacement, including characters only used in proteins (e.g. D, E, F, etc.), characters rarely used in proteins (e.g. U, J, O, etc), digits and punctuation characters.Diagnostic Error Messages None.Exit status
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?