cpgplot.txt

emboss的linux版本的源代码

                                  cpgplot 



Function

   Plot CpG rich areas

Description

   CpG refers to a C nucleotide immediately followed by a G. The 'p' in
   'CpG' refers to the phosphate group linking the two bases.

   Detection of regions of genomic sequences that are rich in the CpG
   pattern is important because such regions are resistant to methylation
   and tend to be associated with genes which are frequently switched on.
   Regions rich in the CpG pattern are known as CpG islands.

   It has been estimated that about half of all mammalian genes have a
   CpG-rich region around their 5' end. It is said that all mammalian
   house-keeping genes have a CpG island!

   Non-mammalian vertebrates have some CpG islands that are associated
   with genes, but the association gets equivocal in the farther
   taxonomic groups.

   Finding a CpG island upstream of predicted exons or genes is good
   contributory evidence.

   By default, this program defines a CpG island as a region where, over
   an average of 10 windows, the calculated % composition is over 50% and
   the calculated Obs/Exp (i.e. Observed/Expected) ratio is over 0.6 and
   the conditions hold for a minimum of 200 bases. These conditions can
   be modified by setting the values of the appropriate parameters.

   The Observed number of CpG patterns in a window is simply the count of
   the number of times a 'C' is found followed immediately by a 'G'.

   The Expected number of CpG patterns is calculated for each window as
   the number of CpG dinucleotides you would expect to see in that window
   based on the frequency of C's and G's in that window. Thus, the
   Expected frequency of CpG's in a window is calculated as the number of
   'C's in the window multiplied by the number of 'G's in the window,
   divided by the window length.

        Expected = (number of C's  * number of G's) / window length


   This program reads in one or more sequences and calculates the Obs/Exp
   ratio, the percentage CpG over a window which is moved along the
   sequence. These calculated values can be plotted, together with the
   regions which match this program's definition of a CpG island.

Usage

   Here is a sample session with cpgplot


% cpgplot tembl:rnu68037 -graph cps 
Plot CpG rich areas
Window size [100]: 
Minimum length of an island [200]: 
Minimum observed/expected [0.6]: 
Minimum percentage [50.]: 
Output file [rnu68037.cpgplot]: 
Features output [rnu68037.gff]: 

Created cpgplot.ps

   Go to the input files for this example
   Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers (* if not always prompted):
  [-sequence]          seqall     Nucleotide sequence(s) filename and optional
                                  format, or reference (input USA)
   -window             integer    [100] The percentage CG content and the
                                  Observed frequency of CG is calculated
                                  within a window whose size is set by this
                                  parameter. The window is moved down the
                                  sequence and these statistics are calculated
                                  at each postition that the window is moved
                                  to. (Integer 1 or more)
   -minlen             integer    [200] This sets the minimum length that a
                                  CpG island has to be before it is reported.
                                  (Integer 1 or more)
   -minoe              float      [0.6] This sets the minimum average observed
                                  to expected ratio of C plus G to CpG in a
                                  set of 10 windows that are required before a
                                  CpG island is reported. (Number from 0.000
                                  to 10.000)
   -minpc              float      [50.] This sets the minimum average
                                  percentage of G plus C a set of 10 windows
                                  that are required before a CpG island is
                                  reported. (Number from 0.000 to 100.000)
  [-outfile]           outfile    [*.cpgplot] This sets the name of the file
                                  holding the report of the input sequence
                                  name, CpG island parameters and the output
                                  details of any CpG islands that are found.
*  -graph              xygraph    [$EMBOSS_GRAPHICS value, or x11] Graph type
                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,
                                  tekt, tek, none, data, xterm, png)
  [-outfeat]           featout    [unknown.gff] File for output features

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -[no]plot           toggle     [Y] Plot CpG island score
   -[no]obsexp         boolean    [Y] If this is set to true then the graph of
                                  the observed to expected ratio of C plus G
                                  to CpG within a window is displayed.
   -[no]cg             boolean    [Y] If this is set to true then the graph of
                                  the regions which have been determined to
                                  be CpG islands is displayed.
   -[no]pc             boolean    [Y] If this is set to true then the graph of
                                  the percentage C plus G within a window is
                                  displayed.

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -odirectory2        string     Output directory

   "-graph" associated qualifiers
   -gprompt            boolean    Graph prompting
   -gdesc              string     Graph description
   -gtitle             string     Graph title
   -gsubtitle          string     Graph subtitle
   -gxtitle            string     Graph x axis title
   -gytitle            string     Graph y axis title
   -goutfile           string     Output file for non interactive displays
   -gdirectory         string     Output directory

   "-outfeat" associated qualifiers
   -offormat3          string     Output feature format
   -ofopenfile3        string     Features file name
   -ofextension3       string     File name extension
   -ofdirectory3       string     Output directory
   -ofname3            string     Base file name
   -ofsingle3          boolean    Separate file for each entry

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write standard output
   -filter             boolean    Read standard input, write standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Input file format

   Any DNA sequence USA.

  Input files for usage example

   'tembl:rnu68037' is a sequence entry in the example nucleic acid
   database 'tembl'

  Database entry: tembl:rnu68037

ID   RNU68037   standard; RNA; ROD; 1218 BP.
XX
AC   U68037;
XX
SV   U68037.1
XX
DT   23-SEP-1996 (Rel. 49, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus EP1 prostanoid receptor mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia
;
OC   Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-1218
RA   Abramovitz M., Boie Y.;
RT   "Cloning of the rat EP1 prostanoid receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-1218
RA   Abramovitz M., Boie Y.;
RT   ;
RL   Submitted (26-AUG-1996) to the EMBL/GenBank/DDBJ databases.
RL   Biochemistry & Molecular Biology, Merck Frosst Center for Therapeutic
RL   Research, P. O. Box 1005, Pointe Claire - Dorval, Quebec H9R 4P8, Canada
XX
DR   SWISS-PROT; P70597; PE21_RAT.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /db_xref="taxon:10116"
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT   CDS             1..1218
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P70597"
FT                   /note="family 1 G-protein coupled receptor"
FT                   /product="EP1 prostanoid receptor"
FT                   /protein_id="AAB07735.1"
FT                   /translation="MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFS
M
FT                   TLGAVSNVLALALLAQVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTA
G
FT                   RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAL
L
FT                   AAMALAVALLPLVHVGHYELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAAL
V
FT                   CNTLSGLALLRARWRRRRSRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALR
S
FT                   SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLA
V
FT                   RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSR
H
FT                   SGFSHL"
XX
SQ   Sequence 1218 BP; 162 A; 397 C; 387 G; 272 T; 0 other;
     atgagcccct acgggcttaa cctgagccta gtggatgagg caacaacgtg tgtaacaccc        6
0
     agggtcccca atacatctgt ggtgctgcca acaggcggta acggcacatc accagcgctg       12
0
     cctatcttct ccatgacgct gggtgctgtg tccaacgtgc tggcgctggc gctgctggcc       18
0
     caggttgcag gcagactgcg gcgccgccgc tcgactgcca ccttcctgtt gttcgtcgcc       24
0
     agcctgcttg ccatcgacct agcaggccat gtgatcccgg gcgccttggt gcttcgcctg       30
0
     tatactgcag gacgtgcgcc cgctggcggg gcctgtcatt tcctgggcgg ctgtatggtc       36
0
     ttctttggcc tgtgcccact tttgcttggc tgtggcatgg ccgtggagcg ctgcgtgggt       42
0
     gtcacgcagc cgctgatcca cgcggcgcgc gtgtccgtag cccgcgcacg cctggcacta       48
0
     gccctgctgg ccgccatggc tttggcagtg gcgctgctgc cactagtgca cgtgggtcac       54
0
     tacgagctac agtaccctgg cacttggtgt ttcattagcc ttgggcctcc tggaggttgg       60
0
     cgccaggcgt tgcttgcggg cctcttcgcc ggccttggcc tggctgcgct ccttgccgca       66
0
     ctagtgtgta atacgctcag cggcctggcg ctccttcgtg cccgctggag gcggcgtcgc       72
0
     tctcgacgtt tccgagagaa cgcaggtccc gatgatcgcc ggcgctgggg gtcccgtgga       78
0
     ctccgcttgg cctccgcctc gtctgcgtca tccatcactt caaccacagc tgccctccgc       84
0
     agctctcggg gaggcggctc cgcgcgcagg gttcacgcac acgacgtgga aatggtgggc       90
0
     cagctcgtgg gcatcatggt ggtgtcgtgc atctgctgga gccccctgct ggtattggtg       96
0
     gtgttggcca tcgggggctg gaactctaac tccctgcagc ggccgctctt tctggctgta      102
0
     cgcctcgcgt cgtggaacca gatcctggac ccatgggtgt acatcctgct gcgccaggct      108
0
     atgctgcgcc aacttcttcg cctcctaccc ctgagggtta gtgccaaggg tggtccaacg      114
0
     gagctgagcc taaccaagag tgcctgggag gccagttcac tgcgtagctc ccggcacagt      120
0
     ggcttcagcc acttgtga                                                    121
8
//

Output file format

  Output files for usage example

  File: rnu68037.cpgplot



CPGPLOT islands of unusual CG composition
RNU68037 from 1 to 1218

     Observed/Expected ratio > 0.60
     Percent C + Percent G > 50.00
     Length > 200

 Length 406 (104..509)

 Length 329 (596..924)

  File: rnu68037.gff

##gff-version 2.0
##date 2006-07-15
##Type DNA RNU68037
RNU68037        cpgplot misc_feature    104     509     0.000   +       .
Sequence "RNU68037.1"
RNU68037        cpgplot misc_feature    596     924     0.000   +       .
Sequence "RNU68037.2"

  Graphics File: cpgplot.ps

   [cpgplot results]

Notes

   None.

References

   The original program was described in:
    1. Larsen F, Gundersen G, Lopez R, Prydz H "CpG islands as gene
       markers in the human genome." Genomics 1992 Aug;13(4):1095-107

Warnings

   None.

Diagnostic Error Messages

   None.

Exit status

   0 if successful.

Known bugs

   None.

See also

   Program name                        Description
   cpgreport    Reports all CpG rich regions
   geecee       Calculates fractional GC content of nucleic acid sequences
   newcpgreport Report CpG rich areas
   newcpgseek   Reports CpG rich regions

   As there is no official definition of what is a cpg island is, and
   worst where they begin and end, we have to live with 2 definitions and
   thus two methods. These are:

   1. newcpgseek and cpgreport - both declare a putative island if the
   score is higher than a threshold (17 at the moment). They now also
   displaying the actual CpG count, the % CG and the observed/expected
   ration in the region where the score is above the threshold. This
   scoring method based on sum/frequencies overpredicts islands but finds
   the smaller ones around primary exons. newcpgseek uses the same method
   as cpgreport but the output is different and more readable.

   2. newcpgreport and cpgplot use a sliding window within which the
   Obs/Exp ratio of CpG is calculated. The important thing to note in
   this method is that an island, in order to be reported, is defined as
   a region that satisfies the following contraints:

   Obs/Exp ratio > 0.6
   % C + % G > 50%
   Length > 200.

   For all practical purposes you should probably use newcpgreport. It is
   actually used to produce the human cpgisland database you can find on
   the EBI's ftp server as well as on the EBI's SRS server.

   geecee measures CG content in the entire input sequence and is not to
   be used to detect CpG islands. It can be usefull for detecting
   sequences that MIGHT contain an island.

Author(s)

   Alan Bleasby (ajb