sigcleave.txt

emboss的linux版本的源代码

//

Output file format

   The output is a standard EMBOSS report file.

   The results can be output in one of several styles by using the
   command-line qualifier -rformat xxx, where 'xxx' is replaced by the
   name of the required format. The available format names are: embl,
   genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel,
   feattable, motif, regions, seqtable, simple, srs, table, tagseq

   See: http://emboss.sf.net/docs/themes/ReportFormats.html for further
   information on report formats.

   By default sigcleave writes a 'motif' report file.

  Output files for usage example

  File: ach2_drome.sig

########################################
# Program: sigcleave
# Rundate: Sat 15 Jul 2006 12:00:00
# Commandline: sigcleave
#    -sequence tsw:ach2_drome
# Report_format: motif
# Report_file: ach2_drome.sig
########################################

#=======================================
#
# Sequence: ACH2_DROME     from: 1   to: 576
# HitCount: 9
#
# Reporting scores over 3.50
#
#=======================================

(1) Score 13.739 length 13 at residues 29->41
 Sequence: LLVLLLLCETVQA
           |           |
          29           41
 mature_peptide: NPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQIL

(2) Score 12.135 length 13 at residues 26->38
 Sequence: LCLLLVLLLLCET
           |           |
          26           38
 mature_peptide: VQANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKD

(3) Score 10.465 length 13 at residues 28->40
 Sequence: LLLVLLLLCETVQ
           |           |
          28           40
 mature_peptide: ANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQI

(4) Score 7.360 length 13 at residues 528->540
 Sequence: FLWLFMIASLVGT
           |           |
         528           540
 mature_peptide: FVILGEAPSLYDDTKAIDVQLSDVAKQIYNLTEKKN

(5) Score 6.981 length 13 at residues 330->342
 Sequence: FTMLLVGLSVVIT
           |           |
         330           342
 mature_peptide: IIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKIN

(6) Score 5.057 length 13 at residues 24->36
 Sequence: KPLCLLLVLLLLC
           |           |
          24           36
 mature_peptide: ETVQANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNL

(7) Score 4.026 length 13 at residues 31->43
 Sequence: VLLLLCETVQANP
           |           |
          31           43
 mature_peptide: DAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTT

(8) Score 3.751 length 13 at residues 527->539
 Sequence: LFLWLFMIASLVG
           |           |
         527           539
 mature_peptide: TFVILGEAPSLYDDTKAIDVQLSDVAKQIYNLTEKKN

(9) Score 3.632 length 13 at residues 308->320
 Sequence: LLISEIIPSTSLA
           |           |
         308           320
 mature_peptide: LPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRL


#---------------------------------------
#---------------------------------------

#---------------------------------------
# Total_sequences: 1
# Total_hitcount: 9
#---------------------------------------

Data files

   EMBOSS data files are distributed with the application and stored in
   the standard EMBOSS data directory, which is defined by the EMBOSS
   environment variable EMBOSS_DATA.

   To see the available EMBOSS data files, run:

% embossdata -showall

   To fetch one of the data files (for example 'Exxx.dat') into your
   current directory for you to inspect or modify, run:

% embossdata -fetch -file Exxx.dat

   Users can provide their own data files in their own directories.
   Project specific files can be put in the current directory, or for
   tidier directory listings in a subdirectory called ".embossdata".
   Files for all EMBOSS runs can be put in the user's home directory, or
   again in a subdirectory called ".embossdata".

   The directories are searched in the following order:
     * . (your current directory)
     * .embossdata (under your current directory)
     * ~/ (your home directory)
     * ~/.embossdata

   Here is the default file for eukaryotic signals:

# Amino acid counts for 161 Eukaryotic Signal Peptides,
# from von Heijne (1986), Nucl. Acids. Res. 14:4683-4690
#
# The cleavage site is between +1 and -1
#
Sample: 161 aligned sequences
#
# R -13 -12 -11 -10  -9  -8  -7  -6  -5  -4  -3  -2  -1  +1  +2 Expect
# - --- --- --- --- --- --- --- --- --- --- --- --- --- --- --- ------
  A  16  13  14  15  20  18  18  17  25  15  47   6  80  18   6  14.5
  C   3   6   9   7   9  14   6   8   5   6  19   3   9   8   3   4.5
  D   0   0   0   0   0   0   0   0   5   3   0   5   0  10  11   8.9
  E   0   0   0   1   0   0   0   0   3   7   0   7   0  13  14  10.0
  F  13   9  11  11   6   7  18  13   4   5   0  13   0   6   4   5.6
  G   4   4   3   6   3  13   3   2  19  34   5   7  39  10   7  12.1
  H   0   0   0   0   0   1   1   0   5   0   0   6   0   4   2   3.4
  I  15  15   8   6  11   5   4   8   5   1  10   5   0   8   7   7.4
  K   0   0   0   1   0   0   1   0   0   4   0   2   0  11   9  11.3
  L  71  68  72  79  78  45  64  49  10  23   8  20   1   8   4  12.1
  M   0   3   7   4   1   6   2   2   0   0   0   1   0   1   2   2.7
  N   0   1   0   1   1   0   0   0   3   3   0  10   0   4   7   7.1
  P   2   0   2   0   0   4   1   8  20  14   0   1   3   0  22   7.4
  Q   0   0   0   1   0   6   1   0  10   8   0  18   3  19  10   6.3
  R   2   0   0   0   0   1   0   0   7   4   0  15   0  12   9   7.6
  S   9   3   8   6  13  10  15  16  26  11  23  17  20  15  10  11.4
  T   2  10   5   4   5  13   7   7  12   6  17   8   6   3  10   9.7
  V  20  25  15  18  13  15  11  27   0  12  32   3   0   8  17  11.1
  W   4   3   3   1   1   2   6   3   1   3   0   9   0   2   0   1.8
  Y   0   1   4   0   0   1   3   1   1   2   0   5   0   1   7   5.6

Notes

   The value of minweight should be at least 3.5. At this level, the
   method should correctly identify 95% of signal peptides, and reject
   95% of non-signal peptides. The cleavage site should be correctly
   predicted in 75-80% of cases.

   If you use matrix tables with a different number of residues before or
   after the cleavage site, you must also set the advanced parameters
   nval and pval.

References

    1. von Heijne, G. "A new method for predicting signal sequence
       cleavage sites" Nucleic Acids Res.: 14:4683 (1986)
    2. von Heijne, G. "Sequence Analysis in Molecular Biology: Treasure
       Trove or Trivial Pursuit" (Acad. Press, (1987), 113-117)

Warnings

   The program will warn you if a nucleic acid sequence is given or if
   the data file is not mathematically accurate.

Diagnostic Error Messages

Exit status

   It exits with status 0 unless an error is reported.

Known bugs

   None.

See also

    Program name                         Description
   antigenic      Finds antigenic sites in proteins
   digest         Protein proteolytic enzyme or reagent cleavage digest
   epestfind      Finds PEST motifs as potential proteolytic cleavage sites
   fuzzpro        Protein pattern search
   fuzztran       Protein pattern search after translation
   helixturnhelix Report nucleic acid binding motifs
   oddcomp        Find protein sequence regions with a biased composition
   patmatdb       Search a protein sequence with a motif
   patmatmotifs   Search a PROSITE motif database with a protein sequence
   pepcoil        Predicts coiled coil regions
   preg           Regular expression search of a protein sequence
   pscan          Scans proteins using PRINTS

Author(s)

   Alan Bleasby (ajb