seqret.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 1,059 行 · 第 1/3 页
TXT
1,059 行
ways depending on where they appear. If these qualifiers immediately follow a parameter they apply only to that parameter and not to all cases. If they occur before any parameters, they apply to all following sequence parameters. If there are no two parameters of equal type, the order of parameters and their qualifiers is irrelevant. Where a qualifier is defined more than once, for example "-sformat" for 2 input sequences to be aligned, the qualifier name can have a number to indicate which sequence is meant. "-sbegin2=25" will apply only to the second sequence, no matter where it appears on the command line. The -sbegin and -send qualifiers take an integer number specifying the position to begin or end reading a sequence. If the number is positive, the number is the position counting from the first base or residue of the sequence. If the number is negative the position is counted from the end of the sequence, so position -1 is the last base or residue of the sequence. (If -sbegin 0 is used, it is assumed to be the same as -sbegin 1 and -send 0 is the same as -send -1.) The filter qualifier makes the program behave like a filter, reading its (first) input 'file' from the standard input, and writing its (first) output 'file' to the standard output. The -filter qualifier will also invoke the -auto qualifier, so the user is never prompted for any missing values. Example:% cat sequence.seq | seqret -filter | lpr The example shows the application seqret being run with the -filter qualifier. The input file is 'piped' into the program using the unix command cat and the output is 'piped' directly to the unix program lpr, which will print it on the printer. When the -options qualifier is used and not all the parameters are given on the command line, it will query the user for those parameters. It will not only query the user for the required parameters as it would do without the -options qualifier, but it will also query the user for the optional parameters. When the -stdout qualifier is used, the user will still be prompted for all the info that is required, but will write to standard output by default. The user will also still be prompted for an output filename, in case the user wants to save the output to a file.Usage Here is a sample session with seqret Extract an entry from a database and write it to a file:% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: Go to the input files for this example Go to the output files for this example Example 2 Read all entries in the database 'tembl' that start with 'hs' and write them to a file. In this example the specification is all done in the command line and to stop Unix getting confused by the '*' character, it has to have a backslash ('\') before it:% seqret tembl:hs\* hsall.seq Reads and writes (returns) sequences Go to the output files for this example Example 3 seqret does not read in features by default because this results in slightly faster performance. If however you wish to read in features with your sequence and write them out on output, using '-feature' will change the default behaviour to use any features present in the sequence. N.B. use embl format for the output file as the default format 'fasta' reports the features in gff (file "<seqname>.gff")% seqret -feature Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: embl::hsfau.embl Go to the output files for this example Example 4 Display the contents of the sequence on the screen:% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: stdout>HSFAU X65923.1 H.sapiens fau mRNAttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgcagctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcgcccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtcgtgctcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggaggccctgactaccctggaagtagcaggccgcatgcttggaggtaaagttcatggttccctggcccgtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaagaagaagacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtgcccacctttggcaagaagaagggccccaatgccaactcttaagtcttttgtaattctggctttctctaataaaaaagccacttagttcagtcaaaaaaaaaa Example 5 Write the result in GCG format by using the qualifier '-osformat'.% seqret -osf gcg Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.gcg]: Go to the output files for this example Example 6 Write the result in GCG format by specifying the format in the output USA on the command line.% seqret -outseq gcg::hsfau.gcg Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfau Example 7 Write the result in GCG format by specifying the format in the output USA at the prompt.% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: gcg::hsfau.gcg Example 8 Write the reverse-complement of a sequence:% seqret -srev Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: Go to the output files for this example Example 9 Extract the bases between the positions starting at 5 and ending at 25:% seqret -sbegin 5 -send 25 Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: Go to the output files for this example Example 10 Extract the bases between the positions starting at 5 and ending at 5 bases before the end of the sequence:% seqret -sbegin 5 -send -5 Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: Go to the output files for this example Example 11 Read all entries in the database 'tembl' that start with 'hs' and write them to a file:% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hs*output sequence(s) [hs989235.fasta]: hsall.seqCommand line arguments Standard (Mandatory) qualifiers: [-sequence] seqall (Gapped) sequence(s) filename and optional format, or reference (input USA) [-outseq] seqoutall [.] Sequence set(s) filename and optional format (output USA) Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -feature boolean Use feature information -firstonly boolean Read one sequence and stop Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outseq" associated qualifiers -osformat2 string Output seq format -osextension2 string File name extension -osname2 string Base file name -osdirectory2 string Output directory -osdbname2 string Database name to add -ossingle2 boolean Separate file for each entry -oufo2 string UFO features -offormat2 string Features format -ofname2 string Features file name -ofdirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format seqret reads one or more sequence USAs. Input files for usage example 'tembl:hsfau' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:hsfauID HSFAU standard; RNA; HUM; 518 BP.XXAC X65923;XXSV X65923.1XXDT 13-MAY-1992 (Rel. 31, Created)DT 23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE H.sapiens fau mRNAXXKW fau gene.XXOS Homo sapiens (human)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN [1]RP 1-518RA Michiels L.M.R.;RT ;RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN [2]RP 1-518RX MEDLINE; 93368957.RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL Oncogene 8:2537-2546(1993).XXDR SWISS-PROT; P35544; UBIM_HUMAN.DR SWISS-PROT; Q05472; RS30_HUMAN.XXFH Key Location/QualifiersFHFT source 1..518FT /chromosome="11q"FT /db_xref="taxon:9606"FT /organism="Homo sapiens"FT /tissue_type="placenta"FT /clone_lib="cDNA"FT /clone="pUIA 631"FT /map="13"FT misc_feature 57..278FT /note="ubiquitin like part"FT CDS 57..458FT /db_xref="SWISS-PROT:P35544"FT /db_xref="SWISS-PROT:Q05472"FT /gene="fau"FT /protein_id="CAA46716.1"FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT misc_feature 98..102FT /note="nucleolar localization signal"FT misc_feature 279..458FT /note="S30 part"FT polyA_signal 484..489FT polyA_site 509XXSQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518//
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?