seqret.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 1,059 行 · 第 1/3 页

TXT
1,059
字号
   ways depending on where they appear.   If these qualifiers immediately follow a parameter they apply only to   that parameter and not to all cases. If they occur before any   parameters, they apply to all following sequence parameters.   If there are no two parameters of equal type, the order of parameters   and their qualifiers is irrelevant.   Where a qualifier is defined more than once, for example "-sformat"   for 2 input sequences to be aligned, the qualifier name can have a   number to indicate which sequence is meant. "-sbegin2=25" will apply   only to the second sequence, no matter where it appears on the command   line.   The -sbegin and -send qualifiers take an integer number specifying the   position to begin or end reading a sequence. If the number is   positive, the number is the position counting from the first base or   residue of the sequence. If the number is negative the position is   counted from the end of the sequence, so position -1 is the last base   or residue of the sequence. (If -sbegin 0 is used, it is assumed to be   the same as -sbegin 1 and -send 0 is the same as -send -1.)   The filter qualifier makes the program behave like a filter, reading   its (first) input 'file' from the standard input, and writing its   (first) output 'file' to the standard output. The -filter qualifier   will also invoke the -auto qualifier, so the user is never prompted   for any missing values.   Example:% cat sequence.seq | seqret -filter | lpr   The example shows the application seqret being run with the -filter   qualifier. The input file is 'piped' into the program using the unix   command cat and the output is 'piped' directly to the unix program   lpr, which will print it on the printer.   When the -options qualifier is used and not all the parameters are   given on the command line, it will query the user for those   parameters. It will not only query the user for the required   parameters as it would do without the -options qualifier, but it will   also query the user for the optional parameters.   When the -stdout qualifier is used, the user will still be prompted   for all the info that is required, but will write to standard output   by default. The user will also still be prompted for an output   filename, in case the user wants to save the output to a file.Usage   Here is a sample session with seqret   Extract an entry from a database and write it to a file:% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]:    Go to the input files for this example   Go to the output files for this example   Example 2   Read all entries in the database 'tembl' that start with 'hs' and   write them to a file. In this example the specification is all done in   the command line and to stop Unix getting confused by the '*'   character, it has to have a backslash ('\') before it:% seqret tembl:hs\*  hsall.seq Reads and writes (returns) sequences   Go to the output files for this example   Example 3   seqret does not read in features by default because this results in   slightly faster performance. If however you wish to read in features   with your sequence and write them out on output, using '-feature' will   change the default behaviour to use any features present in the   sequence. N.B. use embl format for the output file as the default   format 'fasta' reports the features in gff (file "<seqname>.gff")% seqret -feature Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: embl::hsfau.embl   Go to the output files for this example   Example 4   Display the contents of the sequence on the screen:% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: stdout>HSFAU X65923.1 H.sapiens fau mRNAttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgcagctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcgcccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtcgtgctcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggaggccctgactaccctggaagtagcaggccgcatgcttggaggtaaagttcatggttccctggcccgtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaagaagaagacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtgcccacctttggcaagaagaagggccccaatgccaactcttaagtcttttgtaattctggctttctctaataaaaaagccacttagttcagtcaaaaaaaaaa   Example 5   Write the result in GCG format by using the qualifier '-osformat'.% seqret -osf gcg Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.gcg]:    Go to the output files for this example   Example 6   Write the result in GCG format by specifying the format in the output   USA on the command line.% seqret -outseq gcg::hsfau.gcg Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfau   Example 7   Write the result in GCG format by specifying the format in the output   USA at the prompt.% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]: gcg::hsfau.gcg   Example 8   Write the reverse-complement of a sequence:% seqret -srev Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]:    Go to the output files for this example   Example 9   Extract the bases between the positions starting at 5 and ending at   25:% seqret -sbegin 5 -send 25 Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]:    Go to the output files for this example   Example 10   Extract the bases between the positions starting at 5 and ending at 5   bases before the end of the sequence:% seqret -sbegin 5 -send -5 Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hsfauoutput sequence(s) [hsfau.fasta]:    Go to the output files for this example   Example 11   Read all entries in the database 'tembl' that start with 'hs' and   write them to a file:% seqret Reads and writes (returns) sequencesInput (gapped) sequence(s): tembl:hs*output sequence(s) [hs989235.fasta]: hsall.seqCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          seqall     (Gapped) sequence(s) filename and optional                                  format, or reference (input USA)  [-outseq]            seqoutall  [.] Sequence set(s)                                  filename and optional format (output USA)   Additional (Optional) qualifiers: (none)   Advanced (Unprompted) qualifiers:   -feature            boolean    Use feature information   -firstonly          boolean    Read one sequence and stop   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outseq" associated qualifiers   -osformat2          string     Output seq format   -osextension2       string     File name extension   -osname2            string     Base file name   -osdirectory2       string     Output directory   -osdbname2          string     Database name to add   -ossingle2          boolean    Separate file for each entry   -oufo2              string     UFO features   -offormat2          string     Features format   -ofname2            string     Features file name   -ofdirectory2       string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   seqret reads one or more sequence USAs.  Input files for usage example   'tembl:hsfau' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:hsfauID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?