fuzztran.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 601 行 · 第 1/2 页

TXT
601
字号
                                 fuzztran Function   Protein pattern search after translationDescription   fuzztran uses PROSITE style protein patterns to search nucleic acid   sequences translated in the specified frame(s).   Patterns are specifications of a (typically short) length of sequence   to be found. They can specify a search for an exact sequence or they   can allow various ambiguities, matches to variable lengths of sequence   and repeated subsections of the sequence.   fuzztran intelligently selects the optimum searching algorithm to use,   depending on the complexity of the search pattern specified.Usage   Here is a sample session with fuzztran% fuzztran -opt Protein pattern search after translationInput nucleotide sequence(s): tembl:rnopsSearch pattern: RATranslation frames         1 : 1         2 : 2         3 : 3         F : Forward three frames        -1 : -1        -2 : -2        -3 : -3         R : Reverse three frames         6 : All six framesFrame(s) to translate [1]: fGenetic codes         0 : Standard         1 : Standard (with alternative initiation codons)         2 : Vertebrate Mitochondrial         3 : Yeast Mitochondrial         4 : Mold, Protozoan, Coelenterate Mitochondrial and Mycoplasma/Spiroplasma         5 : Invertebrate Mitochondrial         6 : Ciliate Macronuclear and Dasycladacean         9 : Echinoderm Mitochondrial        10 : Euplotid Nuclear        11 : Bacterial        12 : Alternative Yeast Nuclear        13 : Ascidian Mitochondrial        14 : Flatworm Mitochondrial        15 : Blepharisma Macronuclear        16 : Chlorophycean Mitochondrial        21 : Trematode Mitochondrial        22 : Scenedesmus obliquus        23 : Thraustochytrium MitochondrialCode to use [0]: Output report [rnops.fuzztran]:    Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          seqall     Nucleotide sequence(s) filename and optional                                  format, or reference (input USA)   -pattern            pattern    The standard IUPAC one-letter codes for the                                  amino acids are used.                                  The symbol 'x' is used for a position where                                  any amino acid is accepted.                                  Ambiguities are indicated by listing the                                  acceptable amino acids for a given position,                                  between square parentheses '[ ]'. For                                  example: [ALT] stands for Ala or Leu or Thr.                                  Ambiguities are also indicated by listing                                  between a pair of curly brackets '{ }' the                                  amino acids that are not accepted at a gven                                  position. For example: {AM} stands for any                                  amino acid except Ala and Met.                                  Each element in a pattern is separated from                                  its neighbor by a '-'. (Optional in                                  fuzztran)                                  Repetition of an element of the pattern can                                  be indicated by following that element with                                  a numerical value or a numerical range                                  between parenthesis. Examples: x(3)                                  corresponds to x-x-x, x(2,4) corresponds to                                  x-x or x-x-x or x-x-x-x.                                  When a pattern is restricted to either the                                  N- or C-terminal of a sequence, that pattern                                  either starts with a '<' symbol or                                  respectively ends with a '>' symbol.                                  A period ends the pattern. (Optional in                                  fuzztran).                                  For example, [DE](2)HS{P}X(2)PX(2,4)C  [-outfile]           report     [*.fuzztran] Output report file name   Additional (Optional) qualifiers:   -frame              menu       [1] Frame(s) to translate (Values: 1 (1); 2                                  (2); 3 (3); F (Forward three frames); -1                                  (-1); -2 (-2); -3 (-3); R (Reverse three                                  frames); 6 (All six frames))   -table              menu       [0] Code to use (Values: 0 (Standard); 1                                  (Standard (with alternative initiation                                  codons)); 2 (Vertebrate Mitochondrial); 3                                  (Yeast Mitochondrial); 4 (Mold, Protozoan,                                  Coelenterate Mitochondrial and                                  Mycoplasma/Spiroplasma); 5 (Invertebrate                                  Mitochondrial); 6 (Ciliate Macronuclear and                                  Dasycladacean); 9 (Echinoderm                                  Mitochondrial); 10 (Euplotid Nuclear); 11                                  (Bacterial); 12 (Alternative Yeast Nuclear);                                  13 (Ascidian Mitochondrial); 14 (Flatworm                                  Mitochondrial); 15 (Blepharisma                                  Macronuclear); 16 (Chlorophycean                                  Mitochondrial); 21 (Trematode                                  Mitochondrial); 22 (Scenedesmus obliquus);                                  23 (Thraustochytrium Mitochondrial))   Advanced (Unprompted) qualifiers: (none)   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-pattern" associated qualifiers   -pformat            string     File format   -pmismatch          integer    Pattern mismatch   -pname              string     Pattern base name   "-outfile" associated qualifiers   -rformat2           string     Report format   -rname2             string     Base file name   -rextension2        string     File name extension   -rdirectory2        string     Output directory   -raccshow2          boolean    Show accession number in the report   -rdesshow2          boolean    Show description in the report   -rscoreshow2        boolean    Show the score in the report   -rusashow2          boolean    Show the full USA in the report   -rmaxall2           integer    Maximum total hits to report   -rmaxseq2           integer    Maximum hits to report for one sequence   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   fuzztran reads in normal nucleic acid sequence USAs.  Input files for usage example   'tembl:rnops' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:rnopsID   RNOPS      standard; RNA; ROD; 1493 BP.XXAC   Z46957;XXSV   Z46957.1XXDT   20-DEC-1994 (Rel. 42, Created)DT   27-AUG-1996 (Rel. 49, Last updated, Version 8)XXDE   R.norvegicus mRNA for rhodopsin.XXKW   rhodopsin.XXOS   Rattus norvegicus (Norway rat)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Rattus.XXRN   [1]RP   1-1493RA   Huber A., Sander P.H., Paulsen R.;RT   "Phosphorylation of the InaD gene product, a photoreceptor membrane proteinRT   required for recovery of visual excitation";RL   J. Biol. Chem. 271:11710-11717(1996).XXRN   [2]RP   1-1493RA   Huber A.;RT   ;RL   Submitted (20-DEC-1994) to the EMBL/GenBank/DDBJ databases.RL   Huber A., Universitaet Karlsruhe, Zoologie I, Kornblumenstr. 13, 76128RL   Karlsruhe, GermanyXXDR   SWISS-PROT; P51489; OPSD_RAT.XXFH   Key             Location/QualifiersFHFT   source          1..1493FT                   /db_xref="taxon:10116"FT                   /organism="Rattus norvegicus"FT                   /strain="Sprague-Dawley"FT                   /clone="pRO4"FT                   /dev_stage="adult"FT                   /tissue_type="retina"FT                   /cell_type="rod"FT                   /clone_lib="rat retinal library"FT   5'UTR           1..83FT   CDS             84..1130FT                   /citation=[1]FT                   /db_xref="SWISS-PROT:P51489"FT                   /function="phototransduction"FT                   /product="rhodopsin"FT                   /protein_id="CAA87081.1"FT                   /translation="MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFFT                   LLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFT                   FGPTGCNLEGFFATLGGEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMFT                   ALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCFT                   YGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSFT                   NFGPIFMTLPAFFAKTASIYNPIIYIMMNKQFRNCMLTTLCCGKNPLGDDEASATASKTFT                   ETSQVAPA"FT   3'UTR           1128..1493XXSQ   Sequence 1493 BP; 309 A; 475 C; 365 G; 344 T; 0 other;     ggagccgtag gtagctgagc tcgccaggca gccttggtct ctgtctacga acagcccgtg        60     gggcagcctc aagggccgca gccatgaacg gcacagaggg ccccaatttt tatgtgccct       120     tctccaacat cacgggcgtg gtgcgcagcc cctttgagca gccgcagtac tacctggcgg       180     agccatggca gttctccatg ctggcagcct acatgttcct gctcatcgtg ctgggcttcc       240     ccatcaactt cctcacgctc tacgtcaccg tacagcacaa gaagctgcgc acaccactca       300     actacatcct gctcaacttg gctgtggctg acctcttcat ggtcttcgga ggattcacca       360     ccaccctcta cacctcactg catggctact ttgtctttgg gcccacaggc tgcaaccttg       420     agggcttctt tgccaccctt ggaggtgaaa tcggcctgtg gtccctggta gtcctggcca       480     ttgagcgcta cgtggtggtc tgcaagccca tgagcaactt ccgctttggg gagaatcatg       540     ccattatggg tgtggccttc acctgggtca tggcgttggc ctgtgctgct cccccactgg       600     ttggctggtc caggtacatc cccgagggca tgcagtgttc atgtgggatt gactactata       660     cactcaagcc tgaggtcaac aatgagtcct tcgtcatcta catgttcgtg gtccacttca       720     ccatccccat gatcgtcatc ttcttctgct acgggcagct ggtcttcacc gtcaaggagg       780     ccgccgccca gcaacaggag tcggctacca ctcagaaggc agagaaggaa gtcacgcgca       840     tggtcatcat catggtcatc ttcttcctga tctgctggct tccctatgcc agtgtggcca       900     tgtacatctt tacccaccag ggctccaact tcggccccat cttcatgacc cttcccgctt       960     tctttgctaa gaccgcctcc atctacaacc caatcatcta catcatgatg aacaagcagt      1020     tccggaactg catgctcacc acgctctgct gcggcaagaa tccactggga gatgatgagg      1080     cctctgccac tgcctccaag acggagacca gccaggtggc tccagcctaa gcctggccag      1140     agactgtggc tgactgtagg agtctcctgt ccccactcac cccagccaca gcccccacca      1200     ggagcagcac ccgttggaat gaggtcatgc aggctccctc agtgttcttt tctttgtttt      1260     taatgaattc atgaaagcaa aatgaggctc cccactcaac agggacagcc tgacaaagga      132

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?