prettyplot.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 334 行

TXT
334
字号
                                prettyplot Function   Displays aligned sequences, with colouring and boxingDescription   prettyplot reads in a set of aligned DNA or protein sequences. It   displays them graphically, with conserved regions highlighted in   various ways.Usage   Here is a sample session with prettyplot% prettyplot -resbreak=10 -boxcol -consensus -plurality=3 Displays aligned sequences, with colouring and boxingInput (aligned) sequence set: globins.msfGraph type [x11]: cpsCreated prettyplot.ps   Go to the input files for this example   Go to the output files for this example   Example 2% prettyplot globins.msf -plurality=3 -docolour Displays aligned sequences, with colouring and boxingGraph type [x11]: cpsCreated prettyplot.ps   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequences]         seqset     (Aligned) sequence set filename and optional                                  format, or reference (input USA)   -graph              graph      [$EMBOSS_GRAPHICS value, or x11] Graph type                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,                                  tekt, tek, none, data, xterm, png)   Additional (Optional) qualifiers:   -matrixfile         matrix     [EBLOSUM62 for protein, EDNAFULL for DNA]                                  This is the scoring matrix file used when                                  comparing sequences. By default it is the                                  file 'EBLOSUM62' (for proteins) or the file                                  'EDNAFULL' (for nucleic sequences). These                                  files are found in the 'data' directory of                                  the EMBOSS installation.   -residuesperline    integer    [50] The number of residues to be displayed                                  on each line (Any integer value)   -resbreak           integer    [Same as -residuesperline to give no breaks]                                  Residues before a space (Integer 1 or more)   -[no]ccolours       boolean    [Y] Colour residues by their consensus                                  value.   -cidentity          string     [RED] Colour to display identical residues                                  (RED) (Any string is accepted)   -csimilarity        string     [GREEN] Colour to display similar residues                                  (GREEN) (Any string is accepted)   -cother             string     [BLACK] Colour to display other residues                                  (BLACK) (Any string is accepted)   -docolour           boolean    [N] Colour residues by table oily, amide                                  etc.   -shade              string     Set to BPLW for normal shading                                  (black, pale, light, white)                                  so for pair = 1.5,1.0,0.5 and shade = BPLW                                  Residues score Colour                                  1.5 or over... BLACK (B)                                  1.0 to 1.5 ... BROWN (P)                                  0.5 to 1.0 ... WHEAT (L)                                  under 0.5 .... WHITE (W)                                  The only four letters allowed are BPLW, in                                  any order. (Any string up to 4 characters,                                  matching regular expression                                  /^([BPLW]{4})?$/)   -pair               array      [1.5,1.0,0.5] Values to represent identical                                  similar related   -identity           integer    [0] Only match those which are identical in                                  all sequences. (Integer 0 or more)   -[no]box            boolean    [Y] Display prettyboxes   -boxcol             boolean    [N] Colour the background in the boxes   -boxcolval          string     [GREY] Colour to be used for background.                                  (GREY) (Any string is accepted)   -[no]name           boolean    [Y] Display the sequence names   -maxnamelen         integer    [10] Margin size for the sequence name. (Any                                  integer value)   -[no]number         boolean    [Y] Display the residue number   -[no]listoptions    boolean    [Y] Display the date and options used   -plurality          float      [Half the total sequence weighting]                                  Plurality check value (totweight/2) (Any                                  numeric value)   -consensus          boolean    [N] Display the consensus   -[no]collision      boolean    [Y] Allow collisions in calculating                                  consensus   -alternative        menu       [0] Values are 0:Normal collision check.                                  (default)                                  1:Compares identical scores with the max                                  score found. So if any other residue matches                                  the identical score then a collision has                                  occurred.                                  2:If another residue has a greater than or                                  equal to matching score and these do not                                  match then a collision has occurred.                                  3:Checks all those not in the current                                  consensus.If any of these give a top score                                  for matching or identical scores then a                                  collision has occured. (Values: 0 (Normal                                  collision check. (default)); 1 (Compares                                  identical scores with the max score found.                                  So if any other residue matches the                                  identical score then a collision has                                  occurred.); 2 (If another residue has a                                  greater than or equal to matching score and                                  these do not match then a collision has                                  occurred.); 3 (Checks all those not in the                                  current consensus.If any of these give a top                                  score for matching or identical scores then                                  a collision has occured.))   -showscore          integer    [-1] Print residue scores (Any integer                                  value)   -portrait           boolean    [N] Set page to Portrait   Advanced (Unprompted) qualifiers: (none)   Associated qualifiers:   "-sequences" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-graph" associated qualifiers   -gprompt            boolean    Graph prompting   -gdesc              string     Graph description   -gtitle             string     Graph title   -gsubtitle          string     Graph subtitle   -gxtitle            string     Graph x axis title   -gytitle            string     Graph y axis title   -goutfile           string     Output file for non interactive displays   -gdirectory         string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   prettyplot reads any sequence USA.  Input files for usage example  File: globins.msf!!AA_MULTIPLE_ALIGNMENT 1.0  ../data/globins.msf MSF:  164 Type: P 25/06/01 CompCheck: 4278 ..  Name: HBB_HUMAN Len: 164  Check: 6914 Weight: 0.61  Name: HBB_HORSE Len: 164  Check: 6007 Weight: 0.65  Name: HBA_HUMAN Len: 164  Check: 3921 Weight: 0.65  Name: HBA_HORSE Len: 164  Check: 4770 Weight: 0.83  Name: MYG_PHYCA Len: 164  Check: 7930 Weight: 1.00  Name: GLB5_PETMA Len: 164  Check: 1857 Weight: 0.91  Name: LGB2_LUPLU Len: 164  Check: 2879 Weight: 0.43//           1                                               50HBB_HUMAN  ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQRHBB_HORSE  ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQRHBA_HUMAN  ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLSHBA_HORSE  ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLGMYG_PHYCA  ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLEGLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQELGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD           51                                             100HBB_HUMAN  FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSEHBB_HORSE  FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEHBA_HUMAN  FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDHBA_HORSE  FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDMYG_PHYCA  KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQGLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN           101                                            150HBB_HUMAN  LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAHBB_HORSE  LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVAHBA_HUMAN  LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSHBA_HORSE  LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSMYG_PHYCA  SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRGLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSALGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA           151        164HBB_HUMAN  NALAHKYH~~~~~~HBB_HORSE  NALAHKYH~~~~~~HBA_HUMAN  TVLTSKYR~~~~~~HBA_HORSE  TVLTSKYR~~~~~~MYG_PHYCA  KDIAAKYKELGYQGGLB5_PETMA Y~~~~~~~~~~~~~LGB2_LUPLU IVIKKEMNDAA~~~Output file format   An image of the alignment is displayed on the specified graphics   device.  Output files for usage example  Graphics File: prettyplot.ps   [prettyplot results]  Output files for usage example 2  Graphics File: prettyplot.ps   [prettyplot results]Data files   Prettyplot uses a comparison matrix file to calculate similarity to   the consensus.   For protein sequences EBLOSUM62 is used for the substitution matrix.   For nucleotide sequence, EDNAFULL is used.   EMBOSS data files are distributed with the application and stored in   the standard EMBOSS data directory, which is defined by the EMBOSS   environment variable EMBOSS_DATA.   To see the available EMBOSS data files, run:% embossdata -showall   To fetch one of the data files (for example 'Exxx.dat') into your   current directory for you to inspect or modify, run:% embossdata -fetch -file Exxx.dat   Users can provide their own data files in their own directories.   Project specific files can be put in the current directory, or for   tidier directory listings in a subdirectory called ".embossdata".   Files for all EMBOSS runs can be put in the user's home directory, or   again in a subdirectory called ".embossdata".   The directories are searched in the following order:     * . (your current directory)     * .embossdata (under your current directory)     * ~/ (your home directory)     * ~/.embossdataNotes   None.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It exits with status 0 unless an error is reported.Known bugs   Portrait mode does not cover the whole page! This is a "feature" in   plplot.See also   Program name                        Description   abiview      Reads ABI file and display the trace   cirdna       Draws circular maps of DNA constructs   edialign     Local multiple alignment of sequences   emma         Multiple alignment program - interface to ClustalW program   infoalign    Information on a multiple sequence alignment   lindna       Draws linear maps of DNA constructs   pepnet       Displays proteins as a helical net   pepwheel     Shows protein sequences as helices   plotcon      Plot quality of conservation of a sequence alignment   prettyseq    Output sequence with translated ranges   remap        Display sequence with restriction sites, translation etc   seealso      Finds programs sharing group names   showalign    Displays a multiple sequence alignment   showdb       Displays information on the currently available databases   showfeat     Show features of a sequence   showseq      Display a sequence with features, translation etc   sixpack      Display a DNA sequence with 6-frame translation and ORFs   textsearch   Search sequence documentation. Slow, use SRS and Entrez!   tranalign    Align nucleic coding regions given the aligned proteinsAuthor(s)   Ian Longden (il 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?