prettyplot.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 334 行
TXT
334 行
prettyplot Function Displays aligned sequences, with colouring and boxingDescription prettyplot reads in a set of aligned DNA or protein sequences. It displays them graphically, with conserved regions highlighted in various ways.Usage Here is a sample session with prettyplot% prettyplot -resbreak=10 -boxcol -consensus -plurality=3 Displays aligned sequences, with colouring and boxingInput (aligned) sequence set: globins.msfGraph type [x11]: cpsCreated prettyplot.ps Go to the input files for this example Go to the output files for this example Example 2% prettyplot globins.msf -plurality=3 -docolour Displays aligned sequences, with colouring and boxingGraph type [x11]: cpsCreated prettyplot.ps Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-sequences] seqset (Aligned) sequence set filename and optional format, or reference (input USA) -graph graph [$EMBOSS_GRAPHICS value, or x11] Graph type (ps, hpgl, hp7470, hp7580, meta, cps, x11, tekt, tek, none, data, xterm, png) Additional (Optional) qualifiers: -matrixfile matrix [EBLOSUM62 for protein, EDNAFULL for DNA] This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation. -residuesperline integer [50] The number of residues to be displayed on each line (Any integer value) -resbreak integer [Same as -residuesperline to give no breaks] Residues before a space (Integer 1 or more) -[no]ccolours boolean [Y] Colour residues by their consensus value. -cidentity string [RED] Colour to display identical residues (RED) (Any string is accepted) -csimilarity string [GREEN] Colour to display similar residues (GREEN) (Any string is accepted) -cother string [BLACK] Colour to display other residues (BLACK) (Any string is accepted) -docolour boolean [N] Colour residues by table oily, amide etc. -shade string Set to BPLW for normal shading (black, pale, light, white) so for pair = 1.5,1.0,0.5 and shade = BPLW Residues score Colour 1.5 or over... BLACK (B) 1.0 to 1.5 ... BROWN (P) 0.5 to 1.0 ... WHEAT (L) under 0.5 .... WHITE (W) The only four letters allowed are BPLW, in any order. (Any string up to 4 characters, matching regular expression /^([BPLW]{4})?$/) -pair array [1.5,1.0,0.5] Values to represent identical similar related -identity integer [0] Only match those which are identical in all sequences. (Integer 0 or more) -[no]box boolean [Y] Display prettyboxes -boxcol boolean [N] Colour the background in the boxes -boxcolval string [GREY] Colour to be used for background. (GREY) (Any string is accepted) -[no]name boolean [Y] Display the sequence names -maxnamelen integer [10] Margin size for the sequence name. (Any integer value) -[no]number boolean [Y] Display the residue number -[no]listoptions boolean [Y] Display the date and options used -plurality float [Half the total sequence weighting] Plurality check value (totweight/2) (Any numeric value) -consensus boolean [N] Display the consensus -[no]collision boolean [Y] Allow collisions in calculating consensus -alternative menu [0] Values are 0:Normal collision check. (default) 1:Compares identical scores with the max score found. So if any other residue matches the identical score then a collision has occurred. 2:If another residue has a greater than or equal to matching score and these do not match then a collision has occurred. 3:Checks all those not in the current consensus.If any of these give a top score for matching or identical scores then a collision has occured. (Values: 0 (Normal collision check. (default)); 1 (Compares identical scores with the max score found. So if any other residue matches the identical score then a collision has occurred.); 2 (If another residue has a greater than or equal to matching score and these do not match then a collision has occurred.); 3 (Checks all those not in the current consensus.If any of these give a top score for matching or identical scores then a collision has occured.)) -showscore integer [-1] Print residue scores (Any integer value) -portrait boolean [N] Set page to Portrait Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-sequences" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-graph" associated qualifiers -gprompt boolean Graph prompting -gdesc string Graph description -gtitle string Graph title -gsubtitle string Graph subtitle -gxtitle string Graph x axis title -gytitle string Graph y axis title -goutfile string Output file for non interactive displays -gdirectory string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format prettyplot reads any sequence USA. Input files for usage example File: globins.msf!!AA_MULTIPLE_ALIGNMENT 1.0 ../data/globins.msf MSF: 164 Type: P 25/06/01 CompCheck: 4278 .. Name: HBB_HUMAN Len: 164 Check: 6914 Weight: 0.61 Name: HBB_HORSE Len: 164 Check: 6007 Weight: 0.65 Name: HBA_HUMAN Len: 164 Check: 3921 Weight: 0.65 Name: HBA_HORSE Len: 164 Check: 4770 Weight: 0.83 Name: MYG_PHYCA Len: 164 Check: 7930 Weight: 1.00 Name: GLB5_PETMA Len: 164 Check: 1857 Weight: 0.91 Name: LGB2_LUPLU Len: 164 Check: 2879 Weight: 0.43// 1 50HBB_HUMAN ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQRHBB_HORSE ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQRHBA_HUMAN ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLSHBA_HORSE ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLGMYG_PHYCA ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLEGLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQELGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD 51 100HBB_HUMAN FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSEHBB_HORSE FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEHBA_HUMAN FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDHBA_HORSE FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDMYG_PHYCA KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQGLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN 101 150HBB_HUMAN LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAHBB_HORSE LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVAHBA_HUMAN LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSHBA_HORSE LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSMYG_PHYCA SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRGLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSALGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA 151 164HBB_HUMAN NALAHKYH~~~~~~HBB_HORSE NALAHKYH~~~~~~HBA_HUMAN TVLTSKYR~~~~~~HBA_HORSE TVLTSKYR~~~~~~MYG_PHYCA KDIAAKYKELGYQGGLB5_PETMA Y~~~~~~~~~~~~~LGB2_LUPLU IVIKKEMNDAA~~~Output file format An image of the alignment is displayed on the specified graphics device. Output files for usage example Graphics File: prettyplot.ps [prettyplot results] Output files for usage example 2 Graphics File: prettyplot.ps [prettyplot results]Data files Prettyplot uses a comparison matrix file to calculate similarity to the consensus. For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAFULL is used. EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA. To see the available EMBOSS data files, run:% embossdata -showall To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run:% embossdata -fetch -file Exxx.dat Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata". The directories are searched in the following order: * . (your current directory) * .embossdata (under your current directory) * ~/ (your home directory) * ~/.embossdataNotes None.References None.Warnings None.Diagnostic Error Messages None.Exit status It exits with status 0 unless an error is reported.Known bugs Portrait mode does not cover the whole page! This is a "feature" in plplot.See also Program name Description abiview Reads ABI file and display the trace cirdna Draws circular maps of DNA constructs edialign Local multiple alignment of sequences emma Multiple alignment program - interface to ClustalW program infoalign Information on a multiple sequence alignment lindna Draws linear maps of DNA constructs pepnet Displays proteins as a helical net pepwheel Shows protein sequences as helices plotcon Plot quality of conservation of a sequence alignment prettyseq Output sequence with translated ranges remap Display sequence with restriction sites, translation etc seealso Finds programs sharing group names showalign Displays a multiple sequence alignment showdb Displays information on the currently available databases showfeat Show features of a sequence showseq Display a sequence with features, translation etc sixpack Display a DNA sequence with 6-frame translation and ORFs textsearch Search sequence documentation. Slow, use SRS and Entrez! tranalign Align nucleic coding regions given the aligned proteinsAuthor(s) Ian Longden (il
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?