twofeat.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 555 行 · 第 1/2 页

TXT
555
字号
                                  is ignored (always 'Any') when looking at                                  protein sequence features. (Values: A (Any                                  sense); S (Same sense); O (Opposite sense))   -order              menu       [A] This allows you to specify the required                                  order of the two features. The order is                                  measured from the start positions of the                                  features. This criterion is always applied                                  despite the specified overlap type required.                                  (Values: A (Any); AB (Feature A then                                  feature B); BA (Feature B then feature A))   -twoout             toggle     [N] If you set this to be true, then the two                                  features themselves will be written out. If                                  it is left as false, then a single feature                                  will be written out covering the two                                  features you found.*  -typeout            string     [misc_feature] If you have specified that                                  the pairs of features that are found should                                  be reported as one feature in the ouput,                                  then you can specify the 'type' name of the                                  new feature here. By default every feature                                  in the feature table is allowed. See                                  http://www3.ebi.ac.uk/Services/WebFeat/ for                                  a list of the EMBL feature types and see                                  Appendix A of the Swissprot user manual in                                  http://www.expasy.ch/txt/userman.txt for a                                  list of the Swissprot feature types. If you                                  specify an invalid feature type name, then                                  the default name 'misc_feature' is used.                                  (Any string is accepted)   Advanced (Unprompted) qualifiers: (none)   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outfile" associated qualifiers   -rformat2           string     Report format   -rname2             string     Base file name   -rextension2        string     File name extension   -rdirectory2        string     Output directory   -raccshow2          boolean    Show accession number in the report   -rdesshow2          boolean    Show description in the report   -rscoreshow2        boolean    Show the score in the report   -rusashow2          boolean    Show the full USA in the report   -rmaxall2           integer    Maximum total hits to report   -rmaxseq2           integer    Maximum hits to report for one sequence   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   twofeat reads any normal sequence USAs.  Input files for usage example   'tembl:hsfau' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:hsfauID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//Output file format   The output is a standard EMBOSS report file.   The results can be output in one of several styles by using the   command-line qualifier -rformat xxx, where 'xxx' is replaced by the   name of the required format. The available format names are: embl,   genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel,   feattable, motif, regions, seqtable, simple, srs, table, tagseq   See: http://emboss.sf.net/docs/themes/ReportFormats.html for further   information on report formats.   twofeat outputs a report format file. The default format is table  Output files for usage example  File: hsfau.twofeat######################################### Program: twofeat# Rundate: Sat 15 Jul 2006 12:00:00# Commandline: twofeat#    [-sequence] tembl:hsfau#    -atype polyA_signal#    -btype polyA_site#    -minrange 10#    -maxrange 50# Report_format: table# Report_file: hsfau.twofeat#########################################=======================================## Sequence: HSFAU     from: 1   to: 518# HitCount: 1#=======================================  Start     End   Score starta   enda startb   endb    484     509   0.000    484    489    509    509#---------------------------------------#---------------------------------------#---------------------------------------# Total_sequences: 1# Total_hitcount: 1#---------------------------------------  Output files for usage example 2  File: hsfau.twofeat##gff-version 2.0##date 2006-07-15##Type DNA HSFAUHSFAU   EMBL    polyA_signal    484     489     0.000   +       .       Sequence "HSFAU.6"HSFAU   EMBL    polyA_site      509     509     0.000   +       .       Sequence "HSFAU.7" ; FeatFlags "0x40"Data files   None.Notes   It can't find features that are not in the input sequences. It has no   way of checking whether the input features are correct or not.   Remember this when you are searching public databases.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It always exits with status 0.Known bugs   There is a slight memory leak that must be fixed at some time. This   does no affect the results.See also   Program name                      Description   coderet      Extract CDS, mRNA and translations from feature tables   extractfeat  Extract features from a sequence   maskfeat     Mask off features of a sequence   showfeat     Show features of a sequenceAuthor(s)   Gary Williams (gwilliam 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?