btwisted.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 381 行
TXT
381 行
btwisted Function Calculates the twisting in a B-DNA sequenceDescription btwisted takes a region of a pure DNA sequence and calculates by simple arithmetic the probable overall twist of the sequence and the stacking energy.Usage Here is a sample session with btwisted% btwisted -auto tembl:ab000095 -sbegin 100 -send 120 Go to the input files for this example Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-sequence] sequence Nucleotide sequence filename and optional format, or reference (input USA) [-outfile] outfile [*.btwisted] Output file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -angledata datafile [Eangles.dat] DNA base pair twist angle data file -energydata datafile [Eenergy.dat] DNA base pair stacking energies data file Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of the sequence to be used -send1 integer End of the sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -odirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format Nucleic acid sequence USA. Input files for usage example 'tembl:ab000095' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:ab000095ID AB000095 standard; RNA; HUM; 2399 BP.XXAC AB000095;XXSV AB000095.1XXDT 10-MAR-1998 (Rel. 54, Created)DT 10-MAR-1998 (Rel. 54, Last updated, Version 1)XXDE Homo sapiens mRNA for hepatocyte growth factor activator inhibitor,DE complete cds.XXKW hepatocyte growth factor activator inhibitor.XXOS Homo sapiens (human)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN [1]RP 1-2399RA Denda K.;RT ;RL Submitted (24-DEC-1996) to the EMBL/GenBank/DDBJ databases.RL Kimitoshi Denda, Tokyo Institute of Technology, Department of Life Science;RL 4259 Nagatsuta, Midori-ku, Yokohama, Kanagawa 227, JapanRL (E-mail:kdenda@bio.titech.ac.jp, Tel:45-924-5702, Fax:45-924-5771)XXRN [2]RA Shimomura T., Denda K., Kitamura A., Kawaguchi T., Kito M., Kondo J.,RA Kagaya S., Qin L., Takata H., Miyazawa K., Kitamura N.;RT "Hepatocyte growth factor activator inhibitor, a novel Kunitz-type serineRT protease inhibitor";RL J. Biol. Chem. 272:6370-6376(1997).XXDR SWISS-PROT; O43278; SPT1_HUMAN.XXFH Key Location/QualifiersFHFT source 1..2399FT /db_xref="taxon:9606"FT /sequenced_mol="cDNA to mRNA"FT /organism="Homo sapiens"FT CDS 176..1717FT /db_xref="SWISS-PROT:O43278"FT /product="hepatocyte growth factor activator inhibitor"FT /protein_id="BAA25014.1"FT /translation="MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPFT AGADCLNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELFT QPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPFT KAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLFT TVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGFT GCLGNKNNYLREEECILACRGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDFT TPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHFT CARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVIFT CIVVVVAILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL"FT polyA_signal 2379..2384XXSQ Sequence 2399 BP; 490 A; 777 C; 684 G; 448 T; 0 other; cggccgagcc cagctctccg agcaccgggt cggaagccgc gacccgagcc gcgcaggaag 60 ctgggaccgg aacctcggcg gacccggccc cacccaactc acctgcgcag gtcaccagca 120 ccctcggaac ccagaggccc gcgctctgaa ggtgaccccc ctggggagga aggcgatggc 180 ccctgcgagg acgatggccc gcgcccgcct cgccccggcc ggcatccctg ccgtcgcctt 240 gtggcttctg tgcacgctcg gcctccaggg cacccaggcc gggccaccgc ccgcgccccc 300 tgggctgccc gcgggagccg actgcctgaa cagctttacc gccggggtgc ctggcttcgt 360 gctggacacc aacgcctcgg tcagcaacgg agctaccttc ctggagtccc ccaccgtgcg 420 ccggggctgg gactgcgtgc gcgcctgctg caccacccag aactgcaact tggcgctagt 480 ggagctgcag cccgaccgcg gggaggacgc catcgccgcc tgcttcctca tcaactgcct 540 ctacgagcag aacttcgtgt gcaagttcgc gcccagggag ggcttcatca actacctcac 600 gagggaagtg taccgctcct accgccagct gcggacccag ggctttggag ggtctgggat 660 ccccaaggcc tgggcaggca tagacttgaa ggtacaaccc caggaacccc tggtgctgaa 720 ggatgtggaa aacacagatt ggcgcctact gcggggtgac acggatgtca gggtagagag 780 gaaagaccca aaccaggtgg aactgtgggg actcaaggaa ggcacctacc tgttccagct 840 gacagtgact agctcagacc acccagagga cacggccaac gtcacagtca ctgtgctgtc 900 caccaagcag acagaagact actgcctcgc atccaacaag gtgggtcgct gccggggctc 960 tttcccacgc tggtactatg accccacgga gcagatctgc aagagtttcg tttatggagg 1020 ctgcttgggc aacaagaaca actaccttcg ggaagaagag tgcattctag cctgtcgggg 1080 tgtgcaaggc ccctccatgg aaaggcgcca tccagtgtgc tctggcacct gtcagcccac 1140 ccagttccgc tgcagcaatg gctgctgcat cgacagtttc ctggagtgtg acgacacccc 1200 caactgcccc gacgcctccg acgaggctgc ctgtgaaaaa tacacgagtg gctttgacga 1260 gctccagcgc atccatttcc ccagtgacaa agggcactgc gtggacctgc cagacacagg 1320 actctgcaag gagagcatcc cgcgctggta ctacaacccc ttcagcgaac actgcgcccg 1380 ctttacctat ggtggttgtt atggcaacaa gaacaacttt gaggaagagc agcagtgcct 1440 cgagtcttgt cgcggcatct ccaagaagga tgtgtttggc ctgaggcggg aaatccccat 1500 tcccagcaca ggctctgtgg agatggctgt cgcagtgttc ctggtcatct gcattgtggt 1560 ggtggtagcc atcttgggtt actgcttctt caagaaccag agaaaggact tccacggaca 1620 ccaccaccac ccaccaccca cccctgccag ctccactgtc tccactaccg aggacacgga 1680 gcacctggtc tataaccaca ccacccggcc cctctgagcc tgggtctcac cggctctcac 1740 ctggccctgc ttcctgcttg ccaaggcaga ggcctgggct gggaaaaact ttggaaccag 1800 actcttgcct gtttcccagg cccactgtgc ctcagagacc agggctccag cccctcttgg 1860 agaagtctca gctaagctca cgtcctgaga aagctcaaag gtttggaagg agcagaaaac 1920 ccttgggcca gaagtaccag actagatgga cctgcctgca taggagtttg gaggaagttg 1980 gagttttgtt tcctctgttc aaagctgcct gtccctaccc catggtgcta ggaagaggag 2040 tggggtggtg tcagaccctg gaggccccaa ccctgtcctc ccgagctcct cttccatgct 2100 gtgcgcccag ggctgggagg aaggacttcc ctgtgtagtt tgtgctgtaa agagttgctt 2160 tttgtttatt taatgctgtg gcatgggtga agaggagggg aagaggcctg tttggcctct 2220 ctgtcctctc ttcctcttcc cccaagattg agctctctgc ccttgatcag ccccaccctg 2280 gcctagacca gcagacagag ccaggagagg ctcagctgca ttccgcagcc cccaccccca 2340 aggttctcca acatcacagc ccagcccacc cactgggtaa taaaagtggt ttgtggaaa 2399//Output file format Output files for usage example File: ab000095.btwisted# Output from BTWISTED# Twisting calculated from 100 to 120 of AB000095Total twist (degrees): 681.1Total turns : 1.89Average bases per turn: 11.10Total stacking energy : -179.34Average stacking energy per dinucleotide: -8.97Data files The program reads in two data files. The first is prompted for by: "File containing base pair twist angles" This is the data file 'Eangles.dat' by default. This consists of the data:aa 35.6 0.1ac 34.4 1.3ag 27.7 1.5at 31.5 1.1ca 34.5 0.9cc 33.7 0.1cg 29.8 1.1ct 27.7 1.5ga 36.9 0.9gc 40.0 1.2gg 33.7 0.1gt 34.4 1.3ta 36.0 1.0tc 36.9 0.9tg 34.5 0.9tt 35.6 0.1 The second is prompted for by: "File containing base pair stacking energies" This is the data file 'Eenergy.dat' by default. This consists of the data:#base pair stacking energy for B-DNAaa -5.37ac -10.51ag -6.78at -6.57ca -6.57cc -8.26cg -9.69ct -6.78ga -9.81gc -14.59gg -8.26gt -10.51ta -3.82tc -9.81tg -6.57tt -5.37 No check is made that all dinucleotides have been read for the energy and twist. Attempting to run btwisted with an incomplete data file will result a fatal error if the sequence contains a dinucleotide not in the data files. EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA. To see the available EMBOSS data files, run:% embossdata -showall To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run:% embossdata -fetch -file Exxx.dat Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata". The directories are searched in the following order: * . (your current directory) * .embossdata (under your current directory) * ~/ (your home directory) * ~/.embossdataNotes None.References None.Warnings No check is made that all dinucleotides have been read for the energy and twist. Attempting to run btwisted with an incomplete data file will result a fatal error if the sequence contains a dinucleotide not in the data files.Diagnostic Error Messages "Incomplete table" You have supplied data files for either the angles or energies that do not contain the fulll required set of possible dinucleotides.Exit status It always exits with status 0.Known bugs No check is made that all dinucleotides have been read for the energy and twist. Attempting to run btwisted with an incomplete data file will result a fatal error if the sequence contains a dinucleotide not in the data files.See also Program name Description banana Bending and curvature plot in B-DNA chaos Create a chaos game representation plot for a sequence compseq Count composition of dimer/trimer/etc words in a sequence dan Calculates DNA RNA/DNA melting temperature freak Residue/base frequency table or plot isochore Plots isochores in large DNA sequences sirna Finds siRNA duplexes in mRNA wordcount Counts words of a specified size in a DNA sequenceAuthor(s) David Martin (dmartin
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?