btwisted.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 381 行

TXT
381
字号
                                 btwisted Function   Calculates the twisting in a B-DNA sequenceDescription   btwisted takes a region of a pure DNA sequence and calculates by   simple arithmetic the probable overall twist of the sequence and the   stacking energy.Usage   Here is a sample session with btwisted% btwisted -auto tembl:ab000095 -sbegin 100 -send 120    Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          sequence   Nucleotide sequence filename and optional                                  format, or reference (input USA)  [-outfile]           outfile    [*.btwisted] Output file name   Additional (Optional) qualifiers: (none)   Advanced (Unprompted) qualifiers:   -angledata          datafile   [Eangles.dat] DNA base pair twist angle data                                  file   -energydata         datafile   [Eenergy.dat] DNA base pair stacking                                  energies data file   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of the sequence to be used   -send1              integer    End of the sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outfile" associated qualifiers   -odirectory2        string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   Nucleic acid sequence USA.  Input files for usage example   'tembl:ab000095' is a sequence entry in the example nucleic acid   database 'tembl'  Database entry: tembl:ab000095ID   AB000095   standard; RNA; HUM; 2399 BP.XXAC   AB000095;XXSV   AB000095.1XXDT   10-MAR-1998 (Rel. 54, Created)DT   10-MAR-1998 (Rel. 54, Last updated, Version 1)XXDE   Homo sapiens mRNA for hepatocyte growth factor activator inhibitor,DE   complete cds.XXKW   hepatocyte growth factor activator inhibitor.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-2399RA   Denda K.;RT   ;RL   Submitted (24-DEC-1996) to the EMBL/GenBank/DDBJ databases.RL   Kimitoshi Denda, Tokyo Institute of Technology, Department of Life Science;RL   4259 Nagatsuta, Midori-ku, Yokohama, Kanagawa 227, JapanRL   (E-mail:kdenda@bio.titech.ac.jp, Tel:45-924-5702, Fax:45-924-5771)XXRN   [2]RA   Shimomura T., Denda K., Kitamura A., Kawaguchi T., Kito M., Kondo J.,RA   Kagaya S., Qin L., Takata H., Miyazawa K., Kitamura N.;RT   "Hepatocyte growth factor activator inhibitor, a novel Kunitz-type serineRT   protease inhibitor";RL   J. Biol. Chem. 272:6370-6376(1997).XXDR   SWISS-PROT; O43278; SPT1_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..2399FT                   /db_xref="taxon:9606"FT                   /sequenced_mol="cDNA to mRNA"FT                   /organism="Homo sapiens"FT   CDS             176..1717FT                   /db_xref="SWISS-PROT:O43278"FT                   /product="hepatocyte growth factor activator inhibitor"FT                   /protein_id="BAA25014.1"FT                   /translation="MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPFT                   AGADCLNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELFT                   QPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPFT                   KAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLFT                   TVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGFT                   GCLGNKNNYLREEECILACRGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDFT                   TPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHFT                   CARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVIFT                   CIVVVVAILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL"FT   polyA_signal    2379..2384XXSQ   Sequence 2399 BP; 490 A; 777 C; 684 G; 448 T; 0 other;     cggccgagcc cagctctccg agcaccgggt cggaagccgc gacccgagcc gcgcaggaag        60     ctgggaccgg aacctcggcg gacccggccc cacccaactc acctgcgcag gtcaccagca       120     ccctcggaac ccagaggccc gcgctctgaa ggtgaccccc ctggggagga aggcgatggc       180     ccctgcgagg acgatggccc gcgcccgcct cgccccggcc ggcatccctg ccgtcgcctt       240     gtggcttctg tgcacgctcg gcctccaggg cacccaggcc gggccaccgc ccgcgccccc       300     tgggctgccc gcgggagccg actgcctgaa cagctttacc gccggggtgc ctggcttcgt       360     gctggacacc aacgcctcgg tcagcaacgg agctaccttc ctggagtccc ccaccgtgcg       420     ccggggctgg gactgcgtgc gcgcctgctg caccacccag aactgcaact tggcgctagt       480     ggagctgcag cccgaccgcg gggaggacgc catcgccgcc tgcttcctca tcaactgcct       540     ctacgagcag aacttcgtgt gcaagttcgc gcccagggag ggcttcatca actacctcac       600     gagggaagtg taccgctcct accgccagct gcggacccag ggctttggag ggtctgggat       660     ccccaaggcc tgggcaggca tagacttgaa ggtacaaccc caggaacccc tggtgctgaa       720     ggatgtggaa aacacagatt ggcgcctact gcggggtgac acggatgtca gggtagagag       780     gaaagaccca aaccaggtgg aactgtgggg actcaaggaa ggcacctacc tgttccagct       840     gacagtgact agctcagacc acccagagga cacggccaac gtcacagtca ctgtgctgtc       900     caccaagcag acagaagact actgcctcgc atccaacaag gtgggtcgct gccggggctc       960     tttcccacgc tggtactatg accccacgga gcagatctgc aagagtttcg tttatggagg      1020     ctgcttgggc aacaagaaca actaccttcg ggaagaagag tgcattctag cctgtcgggg      1080     tgtgcaaggc ccctccatgg aaaggcgcca tccagtgtgc tctggcacct gtcagcccac      1140     ccagttccgc tgcagcaatg gctgctgcat cgacagtttc ctggagtgtg acgacacccc      1200     caactgcccc gacgcctccg acgaggctgc ctgtgaaaaa tacacgagtg gctttgacga      1260     gctccagcgc atccatttcc ccagtgacaa agggcactgc gtggacctgc cagacacagg      1320     actctgcaag gagagcatcc cgcgctggta ctacaacccc ttcagcgaac actgcgcccg      1380     ctttacctat ggtggttgtt atggcaacaa gaacaacttt gaggaagagc agcagtgcct      1440     cgagtcttgt cgcggcatct ccaagaagga tgtgtttggc ctgaggcggg aaatccccat      1500     tcccagcaca ggctctgtgg agatggctgt cgcagtgttc ctggtcatct gcattgtggt      1560     ggtggtagcc atcttgggtt actgcttctt caagaaccag agaaaggact tccacggaca      1620     ccaccaccac ccaccaccca cccctgccag ctccactgtc tccactaccg aggacacgga      1680     gcacctggtc tataaccaca ccacccggcc cctctgagcc tgggtctcac cggctctcac      1740     ctggccctgc ttcctgcttg ccaaggcaga ggcctgggct gggaaaaact ttggaaccag      1800     actcttgcct gtttcccagg cccactgtgc ctcagagacc agggctccag cccctcttgg      1860     agaagtctca gctaagctca cgtcctgaga aagctcaaag gtttggaagg agcagaaaac      1920     ccttgggcca gaagtaccag actagatgga cctgcctgca taggagtttg gaggaagttg      1980     gagttttgtt tcctctgttc aaagctgcct gtccctaccc catggtgcta ggaagaggag      2040     tggggtggtg tcagaccctg gaggccccaa ccctgtcctc ccgagctcct cttccatgct      2100     gtgcgcccag ggctgggagg aaggacttcc ctgtgtagtt tgtgctgtaa agagttgctt      2160     tttgtttatt taatgctgtg gcatgggtga agaggagggg aagaggcctg tttggcctct      2220     ctgtcctctc ttcctcttcc cccaagattg agctctctgc ccttgatcag ccccaccctg      2280     gcctagacca gcagacagag ccaggagagg ctcagctgca ttccgcagcc cccaccccca      2340     aggttctcca acatcacagc ccagcccacc cactgggtaa taaaagtggt ttgtggaaa       2399//Output file format  Output files for usage example  File: ab000095.btwisted# Output from BTWISTED# Twisting calculated from 100 to 120 of AB000095Total twist (degrees): 681.1Total turns : 1.89Average bases per turn: 11.10Total stacking energy : -179.34Average stacking energy per dinucleotide: -8.97Data files   The program reads in two data files.   The first is prompted for by:   "File containing base pair twist angles"   This is the data file 'Eangles.dat' by default.   This consists of the data:aa      35.6    0.1ac      34.4    1.3ag      27.7    1.5at      31.5    1.1ca      34.5    0.9cc      33.7    0.1cg      29.8    1.1ct      27.7    1.5ga      36.9    0.9gc      40.0    1.2gg      33.7    0.1gt      34.4    1.3ta      36.0    1.0tc      36.9    0.9tg      34.5    0.9tt      35.6    0.1   The second is prompted for by:   "File containing base pair stacking energies"   This is the data file 'Eenergy.dat' by default.   This consists of the data:#base pair stacking energy for B-DNAaa      -5.37ac      -10.51ag      -6.78at      -6.57ca      -6.57cc      -8.26cg      -9.69ct      -6.78ga      -9.81gc      -14.59gg      -8.26gt      -10.51ta      -3.82tc      -9.81tg      -6.57tt      -5.37   No check is made that all dinucleotides have been read for the energy   and twist. Attempting to run btwisted with an incomplete data file   will result a fatal error if the sequence contains a dinucleotide not   in the data files.   EMBOSS data files are distributed with the application and stored in   the standard EMBOSS data directory, which is defined by the EMBOSS   environment variable EMBOSS_DATA.   To see the available EMBOSS data files, run:% embossdata -showall   To fetch one of the data files (for example 'Exxx.dat') into your   current directory for you to inspect or modify, run:% embossdata -fetch -file Exxx.dat   Users can provide their own data files in their own directories.   Project specific files can be put in the current directory, or for   tidier directory listings in a subdirectory called ".embossdata".   Files for all EMBOSS runs can be put in the user's home directory, or   again in a subdirectory called ".embossdata".   The directories are searched in the following order:     * . (your current directory)     * .embossdata (under your current directory)     * ~/ (your home directory)     * ~/.embossdataNotes   None.References   None.Warnings   No check is made that all dinucleotides have been read for the energy   and twist. Attempting to run btwisted with an incomplete data file   will result a fatal error if the sequence contains a dinucleotide not   in the data files.Diagnostic Error Messages   "Incomplete table"   You have supplied data files for either the angles or energies that do   not contain the fulll required set of possible dinucleotides.Exit status   It always exits with status 0.Known bugs   No check is made that all dinucleotides have been read for the energy   and twist. Attempting to run btwisted with an incomplete data file   will result a fatal error if the sequence contains a dinucleotide not   in the data files.See also   Program name                        Description   banana       Bending and curvature plot in B-DNA   chaos        Create a chaos game representation plot for a sequence   compseq      Count composition of dimer/trimer/etc words in a sequence   dan          Calculates DNA RNA/DNA melting temperature   freak        Residue/base frequency table or plot   isochore     Plots isochores in large DNA sequences   sirna        Finds siRNA duplexes in mRNA   wordcount    Counts words of a specified size in a DNA sequenceAuthor(s)   David Martin (dmartin 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?