showalign.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 994 行 · 第 1/4 页

TXT
994
字号
  [-outfile]           outfile    [*.showalign] Output file name   Additional (Optional) qualifiers:   -matrix             matrix     [EBLOSUM62 for protein, EDNAFULL for DNA]                                  This is the scoring matrix file used when                                  comparing sequences. By default it is the                                  file 'EBLOSUM62' (for proteins) or the file                                  'EDNAFULL' (for nucleic sequences). These                                  files are found in the 'data' directory of                                  the EMBOSS installation.   -refseq             string     [0] If you give the number in the alignment                                  or the name of a sequence, it will be taken                                  to be the reference sequence. The reference                                  sequence is always show in full and is the                                  one against which all the other sequences                                  are compared. If this is set to 0 then the                                  consensus sequence will be used as the                                  reference sequence. By default the consensus                                  sequence is used as the reference sequence.                                  (Any string is accepted)   -[no]bottom         boolean    [Y] If this is true then the reference                                  sequence is displayed at the bottom of the                                  alignment as well as at the top.   -show               menu       [N] What to show (Values: A (All of the                                  sequences); I (Identities between the                                  sequences); N (Non-identities between the                                  sequences); S (Similarities between the                                  sequences); D (Dissimilarities between the                                  sequences))   -order              menu       [I] Output order of the sequences (Values: I                                  (Input order - no change); A (Alphabetical                                  order of the names); S (Similarity to the                                  reference sequence))   -[no]similarcase    boolean    [Y] If this is set True, then when -show is                                  set to 'Similarities' or 'Non-identities'                                  and a residue is similar but not identical                                  to the reference sequence residue, it will                                  be changed to lower-case. If -show is set to                                  'All' then non-identical, non-similar                                  residues will be changed to lower-case. If                                  this is False then no change to the case of                                  the residues is made on the basis of their                                  similarity to the reference sequence.   -[no]consensus      boolean    [Y] If this is true then the consensus line                                  is displayed.   Advanced (Unprompted) qualifiers:   -uppercase          range      [If this is left blank, then the sequence                                  case is left alone.] Regions to put in                                  uppercase.                                  If this is left blank, then the sequence                                  case is left alone.                                  A set of regions is specified by a set of                                  pairs of positions.                                  The positions are integers.                                  They are separated by any non-digit,                                  non-alpha character.                                  Examples of region specifications are:                                  24-45, 56-78                                  1:45, 67=99;765..888                                  1,5,8,10,23,45,57,99   -[no]number         boolean    [Y] If this option is true then a line                                  giving the positions in the alignment is                                  displayed every 10 characters above the                                  alignment.   -[no]ruler          boolean    [Y] If this option is true then a ruler line                                  marking every 5th and 10th character in the                                  alignment is displayed.   -width              integer    [60] Width of sequence to display (Integer 1                                  or more)   -margin             integer    [-1] This sets the length of the left-hand                                  margin for sequence names. If the margin is                                  set at 0 then no margin and no names are                                  displayed. If the margin is set to a value                                  that is less than the length of a sequence                                  name then the sequence name is displayed                                  truncated to the length of the margin. If                                  the margin is set to -1 then the minimum                                  margin width that will allow all the                                  sequence names to be displayed in full plus                                  a space at the end of the name will                                  automatically be selected. (Integer -1 or                                  more)   -html               boolean    [N] Use HTML formatting   -highlight          range      [(full sequence)] Regions to colour if                                  formatting for HTML.                                  If this is left blank, then the sequence is                                  left alone.                                  A set of regions is specified by a set of                                  pairs of positions.                                  The positions are integers.                                  They are followed by any valid HTML font                                  colour.                                  Examples of region specifications are:                                  24-45 blue 56-78 orange                                  1-100 green 120-156 red                                  A file of ranges to colour (one range per                                  line) can be specified as '@filename'.   -plurality          float      [50.0] Set a cut-off for the % of positive                                  scoring matches below which there is no                                  consensus. The default plurality is taken as                                  50% of the total weight of all the                                  sequences in the alignment. (Number from                                  0.000 to 100.000)   -setcase            float      [@( $(sequence.totweight) / 2)] Sets the                                  threshold for the scores of the positive                                  matches above which the consensus is in                                  upper-case and below which the consensus is                                  in lower-case. By default this is set to be                                  half of the (weight-adjusted) number of                                  sequences in the alignment. (Any numeric                                  value)   -identity           float      [0.0] Provides the facility of setting the                                  required number of identities at a position                                  for it to give a consensus. Therefore, if                                  this is set to 100% only columns of                                  identities contribute to the consensus.                                  (Number from 0.000 to 100.000)   -[no]gaps           boolean    [Y] If this option is true then gap                                  characters can appear in the consensus. The                                  alternative is 'N' for nucleotide, or 'X'                                  for protein   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outfile" associated qualifiers   -odirectory2        string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   showalign reads in a set of aligned protein or nucleic sequences.  Input files for usage example  File: globins.msf!!AA_MULTIPLE_ALIGNMENT 1.0  ../data/globins.msf MSF:  164 Type: P 25/06/01 CompCheck: 4278 ..  Name: HBB_HUMAN Len: 164  Check: 6914 Weight: 0.61  Name: HBB_HORSE Len: 164  Check: 6007 Weight: 0.65  Name: HBA_HUMAN Len: 164  Check: 3921 Weight: 0.65  Name: HBA_HORSE Len: 164  Check: 4770 Weight: 0.83  Name: MYG_PHYCA Len: 164  Check: 7930 Weight: 1.00  Name: GLB5_PETMA Len: 164  Check: 1857 Weight: 0.91  Name: LGB2_LUPLU Len: 164  Check: 2879 Weight: 0.43//           1                                               50HBB_HUMAN  ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQRHBB_HORSE  ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQRHBA_HUMAN  ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLSHBA_HORSE  ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLGMYG_PHYCA  ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLEGLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQELGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD           51                                             100HBB_HUMAN  FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSEHBB_HORSE  FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEHBA_HUMAN  FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDHBA_HORSE  FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDMYG_PHYCA  KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQGLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN           101                                            150HBB_HUMAN  LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAHBB_HORSE  LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVAHBA_HUMAN  LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSHBA_HORSE  LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSMYG_PHYCA  SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRGLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSALGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA           151        164HBB_HUMAN  NALAHKYH~~~~~~HBB_HORSE  NALAHKYH~~~~~~HBA_HUMAN  TVLTSKYR~~~~~~HBA_HORSE  TVLTSKYR~~~~~~MYG_PHYCA  KDIAAKYKELGYQGGLB5_PETMA Y~~~~~~~~~~~~~LGB2_LUPLU IVIKKEMNDAA~~~   You can specifiy a file of ranges to display in uppercase by giving   the '-uppercase' qualifier the value '@' followed by the name of the   file containing the ranges. (eg: '-upper @myfile').   The format of the range file is:     * Comment lines start with '#' in the first column.     * Comment lines and blank lines are ignored.     * The line may start with white-space.     * There are two positive (integer) numbers per line separated by one       or more space or     * TAB characters.     * The second number must be greater or equal to the first number.     * There can be optional text after the two numbers to annotate the       line.     * White-space before or after the text is removed.   An example range file is:# this is my set of ranges12   23 4   5       this is like 12-23, but smaller67   10348   interesting region   You can specifiy a file of ranges to highlight in a different colour   when outputting in HTML format (using the '-html' qualifier) by giving   the '-highlight' qualifier the value '@' followed by the name of the   file containing the ranges. (eg: '-highlight @myfile').   The format of this file is very similar to the format of the above   uppercase range file, except that the text after the start and end

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?