entret.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 353 行

TXT
353
字号
                                  entret Function   Reads and writes (returns) flatfile entriesDescription   entret reads a sequence from a database or a file and writes the   complete sequence entry to a text file.   The difference between entret and such programs as seqret which also   read entries from databases or files and write them to files, is that   entret reads and writes the complete sequence entry together with the   heading annotation (documentation) without attempting to reformat or   interpret the data in any way. seqret on the other hand will read in   the entry data, determine which bit of it is the sequence, which is   the description line and which is the feature table and will then   write the sequence, description and features out in the way prescribed   by the sequence format which has been requested for output.   entret therefore is very useful for looking at the annotation of   sequences from databases, which seqret does not provide.   The other main difference is that when it writes out the sequence   entry to a file, the information is treated as text, not sequence, and   so options that you would normally use to change the aspects of the   sequence to be written will either not be recognised and will cause an   error message to be written (e.g. '-osformat') or will be quietly   ignored (e.g. '-sbegin', '-send').   In previous versions of EMBOSS, entret didn't return the sequence from   entries held in GCG indexed databases. This has now been fixed. entret   will now return the complete sequence entries with the annotation of   GCG indexed databases.Usage   Here is a sample session with entret% entret tembl:hsfau Reads and writes (returns) flatfile entriesFull text of a sequence database entry output file [hsfau.entret]:    Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          seqall     Sequence(s) filename and optional format, or                                  reference (input USA)  [-outfile]           outfile    [*.entret] Full text of a sequence database                                  entry output file   Additional (Optional) qualifiers: (none)   Advanced (Unprompted) qualifiers:   -firstonly          boolean    Read one sequence and stop   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outfile" associated qualifiers   -odirectory2        string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   entret reads a normal sequence USA.  Input files for usage example   'tembl:hsfau' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:hsfauID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//Output file format  Output files for usage example  File: hsfau.entretID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//Data files   None.Notes   None.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It always exits with status 0.Known bugs   None.See also   Program name                         Description   biosed       Replace or delete sequence sections   codcopy      Reads and writes a codon usage table   cutseq       Removes a specified section from a sequence   degapseq     Removes gap characters from sequences   descseq      Alter the name or description of a sequence   extractalign Extract regions from a sequence alignment   extractfeat  Extract features from a sequence   extractseq   Extract regions from a sequence   listor       Write a list file of the logical OR of two sets of sequences   makenucseq   Creates random nucleotide sequences   makeprotseq  Creates random protein sequences   maskfeat     Mask off features of a sequence   maskseq      Mask off regions of a sequence   newseq       Type in a short new sequence   noreturn     Removes carriage return from ASCII files   notseq       Exclude a set of sequences and write out the remaining ones   nthseq       Writes one sequence from a multiple set of sequences   pasteseq     Insert one sequence into another   revseq       Reverse and complement a sequence   seqret       Reads and writes (returns) sequences   seqretsplit  Reads and writes (returns) sequences in individual files   skipseq      Reads and writes (returns) sequences, skipping first few   splitter     Split a sequence into (overlapping) smaller sequences   trimest      Trim poly-A tails off EST sequences   trimseq      Trim ambiguous bits off the ends of sequences   union        Reads sequence fragments and builds one sequence   vectorstrip  Strips out DNA between a pair of vector sequences   yank         Reads a sequence range, appends the full USA to a list fileAuthor(s)   Alan Bleasby (ajb 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?