entret.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 353 行
TXT
353 行
entret Function Reads and writes (returns) flatfile entriesDescription entret reads a sequence from a database or a file and writes the complete sequence entry to a text file. The difference between entret and such programs as seqret which also read entries from databases or files and write them to files, is that entret reads and writes the complete sequence entry together with the heading annotation (documentation) without attempting to reformat or interpret the data in any way. seqret on the other hand will read in the entry data, determine which bit of it is the sequence, which is the description line and which is the feature table and will then write the sequence, description and features out in the way prescribed by the sequence format which has been requested for output. entret therefore is very useful for looking at the annotation of sequences from databases, which seqret does not provide. The other main difference is that when it writes out the sequence entry to a file, the information is treated as text, not sequence, and so options that you would normally use to change the aspects of the sequence to be written will either not be recognised and will cause an error message to be written (e.g. '-osformat') or will be quietly ignored (e.g. '-sbegin', '-send'). In previous versions of EMBOSS, entret didn't return the sequence from entries held in GCG indexed databases. This has now been fixed. entret will now return the complete sequence entries with the annotation of GCG indexed databases.Usage Here is a sample session with entret% entret tembl:hsfau Reads and writes (returns) flatfile entriesFull text of a sequence database entry output file [hsfau.entret]: Go to the input files for this example Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-sequence] seqall Sequence(s) filename and optional format, or reference (input USA) [-outfile] outfile [*.entret] Full text of a sequence database entry output file Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -firstonly boolean Read one sequence and stop Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -odirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format entret reads a normal sequence USA. Input files for usage example 'tembl:hsfau' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:hsfauID HSFAU standard; RNA; HUM; 518 BP.XXAC X65923;XXSV X65923.1XXDT 13-MAY-1992 (Rel. 31, Created)DT 23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE H.sapiens fau mRNAXXKW fau gene.XXOS Homo sapiens (human)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN [1]RP 1-518RA Michiels L.M.R.;RT ;RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN [2]RP 1-518RX MEDLINE; 93368957.RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL Oncogene 8:2537-2546(1993).XXDR SWISS-PROT; P35544; UBIM_HUMAN.DR SWISS-PROT; Q05472; RS30_HUMAN.XXFH Key Location/QualifiersFHFT source 1..518FT /chromosome="11q"FT /db_xref="taxon:9606"FT /organism="Homo sapiens"FT /tissue_type="placenta"FT /clone_lib="cDNA"FT /clone="pUIA 631"FT /map="13"FT misc_feature 57..278FT /note="ubiquitin like part"FT CDS 57..458FT /db_xref="SWISS-PROT:P35544"FT /db_xref="SWISS-PROT:Q05472"FT /gene="fau"FT /protein_id="CAA46716.1"FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT misc_feature 98..102FT /note="nucleolar localization signal"FT misc_feature 279..458FT /note="S30 part"FT polyA_signal 484..489FT polyA_site 509XXSQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518//Output file format Output files for usage example File: hsfau.entretID HSFAU standard; RNA; HUM; 518 BP.XXAC X65923;XXSV X65923.1XXDT 13-MAY-1992 (Rel. 31, Created)DT 23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE H.sapiens fau mRNAXXKW fau gene.XXOS Homo sapiens (human)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN [1]RP 1-518RA Michiels L.M.R.;RT ;RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN [2]RP 1-518RX MEDLINE; 93368957.RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL Oncogene 8:2537-2546(1993).XXDR SWISS-PROT; P35544; UBIM_HUMAN.DR SWISS-PROT; Q05472; RS30_HUMAN.XXFH Key Location/QualifiersFHFT source 1..518FT /chromosome="11q"FT /db_xref="taxon:9606"FT /organism="Homo sapiens"FT /tissue_type="placenta"FT /clone_lib="cDNA"FT /clone="pUIA 631"FT /map="13"FT misc_feature 57..278FT /note="ubiquitin like part"FT CDS 57..458FT /db_xref="SWISS-PROT:P35544"FT /db_xref="SWISS-PROT:Q05472"FT /gene="fau"FT /protein_id="CAA46716.1"FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT misc_feature 98..102FT /note="nucleolar localization signal"FT misc_feature 279..458FT /note="S30 part"FT polyA_signal 484..489FT polyA_site 509XXSQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518//Data files None.Notes None.References None.Warnings None.Diagnostic Error Messages None.Exit status It always exits with status 0.Known bugs None.See also Program name Description biosed Replace or delete sequence sections codcopy Reads and writes a codon usage table cutseq Removes a specified section from a sequence degapseq Removes gap characters from sequences descseq Alter the name or description of a sequence extractalign Extract regions from a sequence alignment extractfeat Extract features from a sequence extractseq Extract regions from a sequence listor Write a list file of the logical OR of two sets of sequences makenucseq Creates random nucleotide sequences makeprotseq Creates random protein sequences maskfeat Mask off features of a sequence maskseq Mask off regions of a sequence newseq Type in a short new sequence noreturn Removes carriage return from ASCII files notseq Exclude a set of sequences and write out the remaining ones nthseq Writes one sequence from a multiple set of sequences pasteseq Insert one sequence into another revseq Reverse and complement a sequence seqret Reads and writes (returns) sequences seqretsplit Reads and writes (returns) sequences in individual files skipseq Reads and writes (returns) sequences, skipping first few splitter Split a sequence into (overlapping) smaller sequences trimest Trim poly-A tails off EST sequences trimseq Trim ambiguous bits off the ends of sequences union Reads sequence fragments and builds one sequence vectorstrip Strips out DNA between a pair of vector sequences yank Reads a sequence range, appends the full USA to a list fileAuthor(s) Alan Bleasby (ajb
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?