merger.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 668 行 · 第 1/2 页
TXT
668 行
merger Function Merge two overlapping sequencesDescription This joins two overlapping nucleic acid sequences into one merged sequence. It uses a global alignment algorithm (Needleman & Wunsch) to optimally align the sequences and then it creates the merged sequence from the alignment. When there is a mismatch in the alignment between the two sequences, the correct base to include in the resulting sequence is chosen by using the base from the sequence which has the best local sequence quality score. The following heuristic is used to find the sequence quality score: If one of the bases is a 'N', then the other sequence's base is used, else: A window size around the disputed base is used to find the local quality score. This window size is increased from 5, to 10 to 20 bases or until there is a clear decision on the best choice. If there is no best choice after using a window of 20, then the base in the first sequence is used. To calculate the quality of a window of a sequence around a base: * quality = sequence value/length under window either side of the base * sequence value = sum of points in that window * unambiguous bases (ACGTU) score 2 points * ambiguous bases (MRWSYKVHDB) score 1 point * Ns score 0 points * off end of the sequence scores 0 points N.B. This heavily discriminates against the iffy bits at the end of sequence reads. This program was originally written to aid in the reconstruction of mRNA sequences which had been sequenced from both ends as a 5' and 3' EST (cDNA). eg. joining two reads produced by primer walking sequencing. Care should be taken to reverse one of the sequences (e.g. using the qualifier '-sreverse2') if this is required to get them both in the correct orientation. Because it uses a Needleman & Wunsch alignment the required memory may be greater than the available memory when attempting to merge large (cosmid-sized or greater) sequences. The gap open and gap extension penalties have been set at a higher level than is usual (50 and 5). This was experimentally determined to give the best results with a set of poor quality EST test sequences.Usage Here is a sample session with merger% merger Merge two overlapping sequencesInput sequence: tembl:eclacySecond sequence: tembl:eclacaOutput alignment [eclacy.merger]: output sequence [eclacy.fasta]: Go to the input files for this example Go to the output files for this example Typically, one of the sequences will need to be reverse-complemented to put it into the correct orientation to make it join. For example:% merger file1.seq file2.seq -sreverse2 -outseq merged.seqCommand line arguments Standard (Mandatory) qualifiers: [-asequence] sequence Sequence filename and optional format, or reference (input USA) [-bsequence] sequence Sequence filename and optional format, or reference (input USA) [-outfile] align [*.merger] Output alignment file name [-outseq] seqout [.] Sequence filename and optional format (output USA) Additional (Optional) qualifiers: -datafile matrixf [EBLOSUM62 for protein, EDNAFULL for DNA] This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation. -gapopen float [@($(acdprotein)? 50.0 : 50.0 )] Gap opening penalty (Number from 0.000 to 100.000) -gapextend float [@($(acdprotein)? 5.0 : 5.0)] Gap extension penalty (Number from 0.000 to 10.000) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-asequence" associated qualifiers -sbegin1 integer Start of the sequence to be used -send1 integer End of the sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-bsequence" associated qualifiers -sbegin2 integer Start of the sequence to be used -send2 integer End of the sequence to be used -sreverse2 boolean Reverse (if DNA) -sask2 boolean Ask for begin/end/reverse -snucleotide2 boolean Sequence is nucleotide -sprotein2 boolean Sequence is protein -slower2 boolean Make lower case -supper2 boolean Make upper case -sformat2 string Input sequence format -sdbname2 string Database name -sid2 string Entryname -ufo2 string UFO features -fformat2 string Features format -fopenfile2 string Features file name "-outfile" associated qualifiers -aformat3 string Alignment format -aextension3 string File name extension -adirectory3 string Output directory -aname3 string Base file name -awidth3 integer Alignment width -aaccshow3 boolean Show accession number in the header -adesshow3 boolean Show description in the header -ausashow3 boolean Show the full USA in the alignment -aglobal3 boolean Show the full sequence in alignment "-outseq" associated qualifiers -osformat4 string Output seq format -osextension4 string File name extension -osname4 string Base file name -osdirectory4 string Output directory -osdbname4 string Database name to add -ossingle4 boolean Separate file for each entry -oufo4 string UFO features -offormat4 string Features format -ofname4 string Features file name -ofdirectory4 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format merger reads any two sequence USAs of the same type (protein or nucleic acid.) Input files for usage example 'tembl:eclacy' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:eclacyID ECLACY standard; DNA; PRO; 1500 BP.XXAC V00295;XXSV V00295.1XXDT 09-JUN-1982 (Rel. 01, Created)DT 07-JUL-1995 (Rel. 44, Last updated, Version 4)XXDE E. coli lacY gene (codes for lactose permease).XXKW membrane protein.XXOS Escherichia coliOC Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;OC Escherichia.XXRN [1]RP 1-1500RX MEDLINE; 80120651.RA Buechel D.E., Gronenborn B., Mueller-Hill B.;RT "Sequence of the lactose permease gene";RL Nature 283:541-545(1980).XXDR SWISS-PROT; P00722; BGAL_ECOLI.DR SWISS-PROT; P02920; LACY_ECOLI.DR SWISS-PROT; P07464; THGA_ECOLI.XXCC lacZ is a beta-galactosidase and lacA is transacetylase.CC KST ECO.LACYXXFH Key Location/QualifiersFHFT source 1..1500FT /db_xref="taxon:562"FT /organism="Escherichia coli"FT CDS <1..54FT /codon_start=1FT /db_xref="SWISS-PROT:P00722"FT /note="reading frame (lacZ)"FT /transl_table=11FT /protein_id="CAA23570.1"FT /translation="FQLSAGRYHYQLVWCQK"FT CDS 106..1359FT /db_xref="SWISS-PROT:P02920"FT /note="reading frame (lacY)"FT /transl_table=11FT /protein_id="CAA23571.1"FT /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTFT GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILFT VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFTFT INNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLFT WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLFT IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQFT FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTFT LSGPGPLSLLRRQVNEVA"FT CDS 1423..>1500FT /db_xref="SWISS-PROT:P07464"FT /note="reading frame (lacA)"FT /transl_table=11FT /protein_id="CAA23572.1"FT /translation="MNMPMTERIRAGKLFTDMCEGLPEKR"XXSQ Sequence 1500 BP; 315 A; 342 C; 357 G; 486 T; 0 other; ttccagctga gcgccggtcg ctaccattac cagttggtct ggtgtcaaaa ataataataa 60 ccgggcaggc catgtctgcc cgtatttcgc gtaaggaaat ccattatgta ctatttaaaa 120 aacacaaact tttggatgtt cggtttattc tttttctttt acttttttat catgggagcc 180 tacttcccgt ttttcccgat ttggctacat gacatcaacc atatcagcaa aagtgatacg 240 ggtattattt ttgccgctat ttctctgttc tcgctattat tccaaccgct gtttggtctg 300 ctttctgaca aactcgggct gcgcaaatac ctgctgtgga ttattaccgg catgttagtg 360 atgtttgcgc cgttctttat ttttatcttc gggccactgt tacaatacaa cattttagta 420 ggatcgattg ttggtggtat ttatctaggc ttttgtttta acgccggtgc gccagcagta 480 gaggcattta ttgagaaagt cagccgtcgc agtaatttcg aatttggtcg cgcgcggatg 540 tttggctgtg ttggctgggc gctgtgtgcc tcgattgtcg gcatcatgtt caccatcaat 600 aatcagtttg ttttctggct gggctctggc tgtgcactca tcctcgccgt tttactcttt 660 ttcgccaaaa cggatgcgcc ctcttctgcc acggttgcca atgcggtagg tgccaaccat 720 tcggcattta gccttaagct ggcactggaa ctgttcagac agccaaaact gtggtttttg 780 tcactgtatg ttattggcgt ttcctgcacc tacgatgttt ttgaccaaca gtttgctaat 840 ttctttactt cgttctttgc taccggtgaa cagggtacgc gggtatttgg ctacgtaacg 900 acaatgggcg aattacttaa cgcctcgatt atgttctttg cgccactgat cattaatcgc 960 atcggtggga aaaacgccct gctgctggct ggcactatta tgtctgtacg tattattggc 1020 tcatcgttcg ccacctcagc gctggaagtg gttattctga aaacgctgca tatgtttgaa 1080 gtaccgttcc tgctggtggg ctgctttaaa tatattacca gccagtttga agtgcgtttt 1140 tcagcgacga tttatctggt ctgtttctgc ttctttaagc aactggcgat gatttttatg 1200 tctgtactgg cgggcaatat gtatgaaagc atcggtttcc agggcgctta tctggtgctg 1260 ggtctggtgg cgctgggctt caccttaatt tccgtgttca cgcttagcgg ccccggcccg 1320 ctttccctgc tgcgtcgtca ggtgaatgaa gtcgcttaag caatcaatgt cggatgcggc 1380 gcgacgctta tccgaccaac atatcataac ggagtgatcg cattgaacat gccaatgacc 1440 gaaagaataa gagcaggcaa gctatttacc gatatgtgcg aaggcttacc ggaaaaaaga 1500// Database entry: tembl:eclacaID ECLACA standard; DNA; PRO; 1832 BP.XXAC X51872;XXSV X51872.1XXDT 17-APR-1990 (Rel. 23, Created)DT 05-JUL-1999 (Rel. 60, Last updated, Version 5)XXDE Escherichia coli lacA gene for thiogalactoside transacetylaseXXKW lac operon; lacA gene; lacY gene; thiogalactoside transacetylase.XXOS Escherichia coliOC Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;OC Escherichia.XXRN [1]RC (1-1832)RP 1-1832
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?