freak.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 367 行

TXT
367
字号
                                   freak Function   Residue/base frequency table or plotDescription   freak takes one or more sequences as input and a set of bases or   residues to search for. It then calculates the frequency of these   bases/residues in a window as it moves along the sequence. The   frequency is output to a data file or (optionally) plotted.   The default set of bases is 'cg' which will calculate the frequency of   'G' + 'C' bases within the default moving window of 30 bases.Usage   Here is a sample session with freak% freak tembl:hsfau Residue/base frequency table or plotResidue letters [gc]: Output file [hsfau.freak]:    Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers (* if not always prompted):  [-seqall]            seqall     Sequence(s) filename and optional format, or                                  reference (input USA)   -letters            string     [gc] Residue letters (Any string is                                  accepted)*  -graph              xygraph    [$EMBOSS_GRAPHICS value, or x11] Graph type                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,                                  tekt, tek, none, data, xterm, png)*  -outfile            outfile    [*.freak] Output file name   Additional (Optional) qualifiers:   -step               integer    [1] Stepping value (Any integer value)   -window             integer    [30] Averaging window (Any integer value)   Advanced (Unprompted) qualifiers:   -plot               toggle     [N] Produce graphic   Associated qualifiers:   "-seqall" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-graph" associated qualifiers   -gprompt            boolean    Graph prompting   -gdesc              string     Graph description   -gtitle             string     Graph title   -gsubtitle          string     Graph subtitle   -gxtitle            string     Graph x axis title   -gytitle            string     Graph y axis title   -goutfile           string     Output file for non interactive displays   -gdirectory         string     Output directory   "-outfile" associated qualifiers   -odirectory         string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   freak reads normal sequence USAs.  Input files for usage example   'tembl:hsfau' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:hsfauID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//Output file format  Output files for usage example  File: hsfau.freakFREAK of HSFAU from 1 to 518 Window 30 Step 11          0.5000002          0.5333333          0.5666674          0.5333335          0.5333336          0.5666677          0.5666678          0.5666679          0.60000010         0.63333311         0.63333312         0.66666713         0.66666714         0.66666715         0.66666716         0.63333317         0.66666718         0.63333319         0.63333320         0.63333321         0.66666722         0.66666723         0.70000024         0.73333325         0.70000026         0.66666727         0.63333328         0.60000029         0.56666730         0.60000031         0.63333332         0.60000033         0.60000034         0.63333335         0.60000036         0.60000037         0.56666738         0.56666739         0.53333340         0.53333341         0.50000042         0.50000043         0.50000044         0.50000045         0.53333346         0.56666747         0.56666748         0.600000  [Part of this file has been deleted for brevity]439        0.433333440        0.400000441        0.366667442        0.333333443        0.333333444        0.300000445        0.333333446        0.366667447        0.400000448        0.366667449        0.333333450        0.300000451        0.333333452        0.333333453        0.333333454        0.333333455        0.300000456        0.300000457        0.300000458        0.300000459        0.300000460        0.266667461        0.266667462        0.233333463        0.233333464        0.266667465        0.300000466        0.333333467        0.300000468        0.333333469        0.333333470        0.333333471        0.333333472        0.366667473        0.333333474        0.333333475        0.333333476        0.300000477        0.300000478        0.300000479        0.333333480        0.333333481        0.300000482        0.300000483        0.266667484        0.266667485        0.266667486        0.266667487        0.266667488        0.266667489        0.266667   The ouput consists of a title line and then two columns containing the   position of the start of the window and then the frequency in that   window of the bases or residues being searched for.Data files   None.Notes   None.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It always exits with status 0.Known bugs   None.See also   Program name                         Description   backtranambig Back translate a protein sequence to ambiguous codons   backtranseq   Back translate a protein sequence   banana        Bending and curvature plot in B-DNA   btwisted      Calculates the twisting in a B-DNA sequence   chaos         Create a chaos game representation plot for a sequence   charge        Protein charge plot   checktrans    Reports STOP codons and ORF statistics of a protein   compseq       Count composition of dimer/trimer/etc words in a sequence   dan           Calculates DNA RNA/DNA melting temperature   emowse        Protein identification by mass spectrometry   iep           Calculates the isoelectric point of a protein   isochore      Plots isochores in large DNA sequences   mwcontam      Shows molwts that match across a set of files   mwfilter      Filter noisy molwts from mass spec output   octanol       Displays protein hydropathy   pepinfo       Plots simple amino acid properties in parallel   pepstats      Protein statistics   pepwindow     Displays protein hydropathy   pepwindowall  Displays protein hydropathy of a set of sequences   sirna         Finds siRNA duplexes in mRNA   wordcount     Counts words of a specified size in a DNA sequenceAuthor(s)   Alan Bleasby (ajb 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?