pepnet.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 288 行

TXT
288
字号
                                  pepnet Function   Displays proteins as a helical netDescription   This is a method of displaying the residues of a protein in a simple   3,4,3,4 repeating pattern that emulates at a simple level the   arrangement of residues around an alpha helix.   It is therefore easy to see patterns of amphipathicity that you may   wish to investigate in more detail by using displays such as pepwheel.   You can specify which residues to mark up in squares, diamonds and   octagons.Usage   Here is a sample session with pepnet% pepnet -sask Displays proteins as a helical netInput protein sequence: tsw:gcn4_yeast     Begin at position [start]: 253       End at position [end]: 274Graph type [x11]: cpsCreated pepnet.ps   Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          sequence   Protein sequence filename and optional                                  format, or reference (input USA)   -graph              graph      [$EMBOSS_GRAPHICS value, or x11] Graph type                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,                                  tekt, tek, none, data, xterm, png)   Additional (Optional) qualifiers (* if not always prompted):*  -squares            string     [ILVM] By default the aliphatic residues                                  ILVM are marked with squares. (Any string is                                  accepted)*  -diamonds           string     [DENQST] By default the residues DENQST are                                  marked with diamonds. (Any string is                                  accepted)*  -octags             string     [HKR] By default the positively charged                                  residues HKR are marked with octagons. (Any                                  string is accepted)   Advanced (Unprompted) qualifiers:   -amphipathic        toggle     If this is true then the residues ACFGILMVWY                                  are marked as squares and all other                                  residues are unmarked. This overrides any                                  other markup that you may have specified                                  using the qualifiers '-squares', '-diamonds'                                  and '-octags'.   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of the sequence to be used   -send1              integer    End of the sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-graph" associated qualifiers   -gprompt            boolean    Graph prompting   -gdesc              string     Graph description   -gtitle             string     Graph title   -gsubtitle          string     Graph subtitle   -gxtitle            string     Graph x axis title   -gytitle            string     Graph y axis title   -goutfile           string     Output file for non interactive displays   -gdirectory         string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   pepnet reads any protein sequence USA.  Input files for usage example   'tsw:gcn4_yeast' is a sequence entry in the example protein database   'tsw'  Database entry: tsw:gcn4_yeastID   GCN4_YEAST     STANDARD;      PRT;   281 AA.AC   P03069; P03068;DT   21-JUL-1986 (Rel. 01, Created)DT   21-JUL-1986 (Rel. 01, Last sequence update)DT   15-JUL-1999 (Rel. 38, Last annotation update)DE   GENERAL CONTROL PROTEIN GCN4 (AMINO ACID BIOSYNTHESIS REGULATORYDE   PROTEIN).GN   GCN4 OR ARG9 OR AAS3 OR YEL009C.OS   Saccharomyces cerevisiae (Baker's yeast).OC   Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales;OC   Saccharomycetaceae; Saccharomyces.RN   [1]RP   SEQUENCE FROM N.A.RX   MEDLINE; 85038531.RA   HINNEBUSCH A.G.;RT   "Evidence for translational regulation of the activator of generalRT   amino acid control in yeast.";RL   Proc. Natl. Acad. Sci. U.S.A. 81:6442-6446(1984).RN   [2]RP   SEQUENCE FROM N.A.RX   MEDLINE; 84298088.RA   THIREOS G., PENN M.D., GREER H.;RT   "5' untranslated sequences are required for the translational controlRT   of a yeast regulatory gene.";RL   Proc. Natl. Acad. Sci. U.S.A. 81:5096-5100(1984).RN   [3]RP   SEQUENCE FROM N.A.RC   STRAIN=S288C / AB972;RA   DIETRICH F.S., MULLIGAN J.T., HENNESSEY K.M., ALLEN E., ARAUJO R.,RA   AVILES E., BERNO A., BRENNAN T., CARPENTER J., CHEN E., CHERRY J.M.,RA   CHUNG E., DUNCAN M., GUZMAN E., HARTZELL G., HUNICKE-SMITH S.,RA   HYMAN R., KAYSER A., KOMP C., LASHKARI D., LEW H., LIN D.,RA   MOSEDALE D., NAKAHARA K., NAMATH A., NORGREN R., OEFNER P., OH C.,RA   PETEL F.X., ROBERTS D., SEHL P., SCHRAMM S., SHOGREN T., SMITH V.,RA   TAYLOR P., WEI Y., YELTON M., BOTSTEIN D., DAVIS R.W.;RL   Submitted (DEC-1994) to the EMBL/GenBank/DDBJ databases.RN   [4]RP   DOMAINS.RX   MEDLINE; 87002456.RA   HOPE I.A., STRUHL K.;RT   "Functional dissection of a eukaryotic transcriptional activatorRT   protein, GCN4 of yeast.";RL   Cell 46:885-894(1986).RN   [5]RP   X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 250-281.RX   MEDLINE; 92054531.RA   O'SHEA E.K., KLEMM J.D., KIM P.S., ALBER T.;RT   "X-ray structure of the GCN4 leucine zipper, a two-stranded, parallelRT   coiled coil.";RL   Science 254:539-544(1991).  [Part of this file has been deleted for brevity]CC   -!- SUBCELLULAR LOCATION: NUCLEAR.CC   -!- SIMILARITY: TO OTHER BZIP PROTEINS.CC   --------------------------------------------------------------------------CC   This SWISS-PROT entry is copyright. It is produced through a collaborationCC   between  the Swiss Institute of Bioinformatics  and the  EMBL outstation -CC   the European Bioinformatics Institute.  There are no  restrictions on  itsCC   use  by  non-profit  institutions as long  as its content  is  in  no  wayCC   modified and this statement is not removed.  Usage  by  and for commercialCC   entities requires a license agreement (See http://www.isb-sib.ch/announce/CC   or send an email to license@isb-sib.ch).CC   --------------------------------------------------------------------------DR   EMBL; K02205; AAA34640.1; -.DR   EMBL; K02649; AAA65521.1; -.DR   EMBL; U18530; AAB64486.1; -.DR   PIR; A03604; RGBYA1.DR   PIR; A03605; RGBYA2.DR   PDB; 1ZTA; 15-APR-93.DR   PDB; 2ZTA; 15-OCT-92.DR   PDB; 1YSA; 31-OCT-93.DR   PDB; 1DGC; 22-JUN-94.DR   PDB; 2DGC; 08-MAR-96.DR   PDB; 1GCL; 03-JUN-95.DR   PDB; 1GCM; 29-JAN-96.DR   PDB; 1SWI; 08-NOV-96.DR   PDB; 1ZII; 07-JUL-97.DR   PDB; 1ZIJ; 07-JUL-97.DR   PDB; 1ZIK; 07-JUL-97.DR   PDB; 1ZIL; 07-JUL-97.DR   PDB; 1ZIM; 07-JUL-97.DR   PDB; 1PIQ; 30-SEP-98.DR   PDB; 1CE9; 25-MAR-99.DR   TRANSFAC; T00321; -.DR   SGD; L0000683; GCN4.DR   PFAM; PF00170; bZIP; 1.DR   PROSITE; PS00036; BZIP_BASIC; 1.KW   Amino-acid biosynthesis; Transcription regulation; Activator;KW   DNA-binding; Nuclear protein; 3D-structure.FT   DOMAIN      106    125       REQUIRED FOR TRANSCRIPTIONAL ACTIVATION.FT   DNA_BIND    231    249       BASIC MOTIF.FT   DOMAIN      253    274       LEUCINE-ZIPPER.FT   CONFLICT    239    281       ARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGFT                                ER -> PGVLVRESCKE (IN REF. 2).FT   HELIX       227    276FT   TURN        277    277SQ   SEQUENCE   281 AA;  31310 MW;  A2155238 CRC32;     MSEYQPSLFA LNPMGFSPLD GSKSTNENVS ASTSTAKPMV GQLIFDKFIK TEEDPIIKQD     TPSNLDFDFA LPQTATAPDA KTVLPIPELD DAVVESFFSS STDSTPMFEY ENLEDNSKEW     TSLFDNDIPV TTDDVSLADK AIESTEEVSL VPSNLEVSTT SFLPTPVLED AKLTQTRKVK     KPNSVVKKSH HVGKDDESRL DHLGVVAYNR KQRSIPLSPI VPESSDPAAL KRARNTEAAR     RSRARKLQRM KQLEDKVEEL LSKNYHLENE VARLKKLVGE R//Output file format  Output files for usage example  Graphics File: pepnet.ps   [pepnet results]Data files   None.Notes   None.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It exits with a status of 0.Known bugs   None.See also    Program name                         Description   abiview        Reads ABI file and display the trace   cirdna         Draws circular maps of DNA constructs   garnier        Predicts protein secondary structure   helixturnhelix Report nucleic acid binding motifs   hmoment        Hydrophobic moment calculation   lindna         Draws linear maps of DNA constructs   pepcoil        Predicts coiled coil regions   pepwheel       Shows protein sequences as helices   prettyplot     Displays aligned sequences, with colouring and boxing   prettyseq      Output sequence with translated ranges   remap          Display sequence with restriction sites, translation etc   seealso        Finds programs sharing group names   showalign      Displays a multiple sequence alignment   showdb         Displays information on the currently available databases   showfeat       Show features of a sequence   showseq        Display a sequence with features, translation etc   sixpack        Display a DNA sequence with 6-frame translation and ORFs   textsearch     Search sequence documentation. Slow, use SRS and Entrez!   tmap           Displays membrane spanning regionsAuthor(s)   Alan Bleasby (ajb 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?