trimest.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 341 行

TXT
341
字号
                                  trimest Function   Trim poly-A tails off EST sequencesDescription   EST and mRNA sequences often have poly-A tails at the end of them.   This utility removes those poly-A tails.   EST sequences are often the reverse complement of the corresponding   mRNA's forward sense and have poly-T tails at their 5' end. By   default, this program also detects and removes these and writes out   the reverse complement of the sequence.   trimest is not infallible. There are often repeats of 'A' (or 'T') in   a sequence that just happen by chance to occur at the 3' (or 5') end   of the EST sequence. trimest has no way of determining if the A's it   finds are part of a real poly-A tail or are a part of the transcribed   genomic sequence. It removes any apparent poly-A tails that match its   criteria for a poly-A tail.   trimest looks for a repeat of at least '-minlength' A's at the 3' end   (and, by default, '-minlength' T's at the 5' end). If there are an   apparent 5' poly-T tail and a poly-A tail, then it removes whichever   is the longer of the two.   By default, it will allow '-mismatches' non-A (or non-T) bases in the   tail. If a mismatch is found, then there has to be at least   '-minlength' A's (or T's) past the mismatch (working from the end) for   the mismatch to be considered part of the tail. If '-mismatches' is   greater than 1 then that number of contiguous non-A (or non-T) bases   will be allowed as part of the tail.   If a 5' poly-T tail is found, then the sequence will be optionally   reverse-complemented when it is written out.   If a poly-A tail is reomved then '[poly-A tail removed]' is appended   to the description of the sequence. If poly-T is removed, then   '[poly-T tail removed]' is appended and if the sequence is reversed,   '[reverse complement]' is appended.Usage   Here is a sample session with trimest% trimest tembl:hsfau hsfau.seq Trim poly-A tails off EST sequences   Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          seqall     Nucleotide sequence(s) filename and optional                                  format, or reference (input USA)  [-outseq]            seqoutall  [.] Sequence set(s)                                  filename and optional format (output USA)   Additional (Optional) qualifiers:   -minlength          integer    [4] This is the minimum length that a poly-A                                  (or poly-T) tail must have before it is                                  removed. If there are mismatches in the tail                                  than there must be at least this length of                                  poly-A tail before the mismatch for the                                  mismatch to be considered part of the tail.                                  (Integer 1 or more)   -mismatches         integer    [1] If there are this number or fewer                                  contiguous non-A bases in a poly-A tail                                  then, if there are '-minlength' 'A' bases                                  before them, they will be considered part of                                  the tail and removed .                                  For example the terminal 4 A's of GCAGAAAA                                  would be removed with the default values of                                  -minlength=4 and -mismatches=1 (There are                                  not at least 4 A's before the last 'G' and                                  so only the A's after it are considered to                                  be part of the tail). The terminal 9 bases                                  of GCAAAAGAAAA would be removed; There are                                  at least -minlength A's preceeding the last                                  'G', so it is part of the tail. (Integer 0                                  or more)   -[no]reverse        boolean    [Y] When a poly-T region at the 5' end of                                  the sequence is found and removed, it is                                  likely that the sequence is in the reverse                                  sense. This option will change the sequence                                  to the forward sense when it is written out.                                  If this option is not set, then the sense                                  will not be changed.   -tolower            toggle     [N] The poly-A region can be 'masked' by                                  converting the sequence characters to                                  lower-case. Some non-EMBOSS programs e.g.                                  fasta can interpret this as a masked region.                                  The sequence is unchanged apart from the                                  case change. You might like to ensure that                                  the whole sequence is in upper-case before                                  masking the specified regions to lower-case                                  by using the '-supper' sequence qualifier.   Advanced (Unprompted) qualifiers:   -[no]fiveprime      boolean    [Y] If this is set true, then the 5' end of                                  teh sequence is inspected for poly-T tails.                                  These will be removed if they are longer                                  than any 3' poly-A tails. If this is false,                                  then the 5' end is ignored.   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of each sequence to be used   -send1              integer    End of each sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outseq" associated qualifiers   -osformat2          string     Output seq format   -osextension2       string     File name extension   -osname2            string     Base file name   -osdirectory2       string     Output directory   -osdbname2          string     Database name to add   -ossingle2          boolean    Separate file for each entry   -oufo2              string     UFO features   -offormat2          string     Features format   -ofname2            string     Features file name   -ofdirectory2       string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   trimest reads the USA of one or more normal nucleic acid sequences.  Input files for usage example   'tembl:hsfau' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:hsfauID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//Output file format  Output files for usage example  File: hsfau.seq>HSFAU X65923.1 H.sapiens fau mRNA [poly-A tail removed]ttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgcagctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcgcccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtcgtgctcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggaggccctgactaccctggaagtagcaggccgcatgcttggaggtaaagttcatggttccctggcccgtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaagaagaagacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtgcccacctttggcaagaagaagggccccaatgccaactcttaagtcttttgtaattctggctttctctaataaaaaagccacttagttcagtc   The output is a set of sequences with the poly-A (or poly-T) tails   removed. If a sequence had a 5' poly-T tail then the resulting   sequence is reverse-complemented by default. The description line has   a comment appended about the changes made to the sequence.Data files   None.Notes   None.References   None.Warnings   It will trim any run of more than -minlength A's or T's at the 3' or   5' end, whether or not they are a true poly-A tail.Diagnostic Error Messages   None.Exit status   It always exits with status 0.Known bugs   None.See also   Program name                         Description   biosed       Replace or delete sequence sections   codcopy      Reads and writes a codon usage table   cutseq       Removes a specified section from a sequence   degapseq     Removes gap characters from sequences   descseq      Alter the name or description of a sequence   entret       Reads and writes (returns) flatfile entries   extractalign Extract regions from a sequence alignment   extractfeat  Extract features from a sequence   extractseq   Extract regions from a sequence   listor       Write a list file of the logical OR of two sets of sequences   makenucseq   Creates random nucleotide sequences   makeprotseq  Creates random protein sequences   maskfeat     Mask off features of a sequence   maskseq      Mask off regions of a sequence   newseq       Type in a short new sequence   noreturn     Removes carriage return from ASCII files   notseq       Exclude a set of sequences and write out the remaining ones   nthseq       Writes one sequence from a multiple set of sequences   pasteseq     Insert one sequence into another   revseq       Reverse and complement a sequence   seqret       Reads and writes (returns) sequences   seqretsplit  Reads and writes (returns) sequences in individual files   skipseq      Reads and writes (returns) sequences, skipping first few   splitter     Split a sequence into (overlapping) smaller sequences   trimseq      Trim ambiguous bits off the ends of sequences   union        Reads sequence fragments and builds one sequence   vectorstrip  Strips out DNA between a pair of vector sequences   yank         Reads a sequence range, appends the full USA to a list fileAuthor(s)   Gary Williams (gwilliam 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?