newcpgreport.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 336 行
TXT
336 行
newcpgreport Function Report CpG rich areasDescription This application is used in the production of the CpG Island database 'CPGISLE'. It produces CPGISLE database entry format reports for a potential CpG island. See the FTP site: ftp://ftp.ebi.ac.uk/pub/databases/cpgisle/ for the finished database. CpG refers to a C nucleotide immediately followed by a G. The 'p' in 'CpG' refers to the phosphate group linking the two bases. Detection of regions of genomic sequences that are rich in the CpG pattern is important because such regions are resistant to methylation and tend to be associated with genes which are frequently switched on. Regions rich in the CpG pattern are known as CpG islands. It has been estimated that about half of all mammalian genes have a CpG-rich region around their 5' end. It is said that all mammalian house-keeping genes have a CpG island! Non-mammalian vertebrates have some CpG islands that are associated with genes, but the association gets equivocal in the farther taxonomic groups. Finding a CpG island upstream of predicted exons or genes is good contributory evidence for that gene's existance. By default, this program defines a CpG island as a region where, over an average of 10 windows, the calculated % composition is over 50% and the calculated Obs/Exp ratio is over 0.6 and the conditions hold for a minimum of 200 bases. These conditions can be modified by setting the values of the appropriate parameters. The Expected number of CpG patterns in a window is calculated as the number of 'C's in the window multiplied by the number of 'G's in the window, divided by the window length. This program reads in one or more sequences and finds regions where there is a high absolute frequency of CpG dimers as well as a high proportion of CpG compared to GpC.Usage Here is a sample session with newcpgreport% newcpgreport Report CpG rich areasInput nucleotide sequence(s): tembl:rnu68037Window size [100]: Shift increment [1]: Minimum Length [200]: Minimum observed/expected [0.6]: Minimum percentage [50.]: Output file [rnu68037.newcpgreport]: Go to the input files for this example Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-sequence] seqall Nucleotide sequence(s) filename and optional format, or reference (input USA) -window integer [100] Window size (Integer 1 or more) -shift integer [1] Shift increment (Integer 1 or more) -minlen integer [200] Minimum Length (Integer 1 or more) -minoe float [0.6] Minimum observed/expected (Number from 0.000 to 10.000) -minpc float [50.] Minimum percentage (Number from 0.000 to 100.000) [-outfile] outfile [*.newcpgreport] Output file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -odirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format newcpgreport reads one or more nucleic acid sequences. Input files for usage example 'tembl:rnu68037' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:rnu68037ID RNU68037 standard; RNA; ROD; 1218 BP.XXAC U68037;XXSV U68037.1XXDT 23-SEP-1996 (Rel. 49, Created)DT 04-MAR-2000 (Rel. 63, Last updated, Version 2)XXDE Rattus norvegicus EP1 prostanoid receptor mRNA, complete cds.XXKW .XXOS Rattus norvegicus (Norway rat)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Rattus.XXRN [1]RP 1-1218RA Abramovitz M., Boie Y.;RT "Cloning of the rat EP1 prostanoid receptor";RL Unpublished.XXRN [2]RP 1-1218RA Abramovitz M., Boie Y.;RT ;RL Submitted (26-AUG-1996) to the EMBL/GenBank/DDBJ databases.RL Biochemistry & Molecular Biology, Merck Frosst Center for TherapeuticRL Research, P. O. Box 1005, Pointe Claire - Dorval, Quebec H9R 4P8, CanadaXXDR SWISS-PROT; P70597; PE21_RAT.XXFH Key Location/QualifiersFHFT source 1..1218FT /db_xref="taxon:10116"FT /organism="Rattus norvegicus"FT /strain="Sprague-Dawley"FT CDS 1..1218FT /codon_start=1FT /db_xref="SWISS-PROT:P70597"FT /note="family 1 G-protein coupled receptor"FT /product="EP1 prostanoid receptor"FT /protein_id="AAB07735.1"FT /translation="MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFSMFT TLGAVSNVLALALLAQVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTAGFT RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALALLFT AAMALAVALLPLVHVGHYELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAALVFT CNTLSGLALLRARWRRRRSRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALRSFT SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVFT RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSRHFT SGFSHL"XXSQ Sequence 1218 BP; 162 A; 397 C; 387 G; 272 T; 0 other; atgagcccct acgggcttaa cctgagccta gtggatgagg caacaacgtg tgtaacaccc 60 agggtcccca atacatctgt ggtgctgcca acaggcggta acggcacatc accagcgctg 120 cctatcttct ccatgacgct gggtgctgtg tccaacgtgc tggcgctggc gctgctggcc 180 caggttgcag gcagactgcg gcgccgccgc tcgactgcca ccttcctgtt gttcgtcgcc 240 agcctgcttg ccatcgacct agcaggccat gtgatcccgg gcgccttggt gcttcgcctg 300 tatactgcag gacgtgcgcc cgctggcggg gcctgtcatt tcctgggcgg ctgtatggtc 360 ttctttggcc tgtgcccact tttgcttggc tgtggcatgg ccgtggagcg ctgcgtgggt 420 gtcacgcagc cgctgatcca cgcggcgcgc gtgtccgtag cccgcgcacg cctggcacta 480 gccctgctgg ccgccatggc tttggcagtg gcgctgctgc cactagtgca cgtgggtcac 540 tacgagctac agtaccctgg cacttggtgt ttcattagcc ttgggcctcc tggaggttgg 600 cgccaggcgt tgcttgcggg cctcttcgcc ggccttggcc tggctgcgct ccttgccgca 660 ctagtgtgta atacgctcag cggcctggcg ctccttcgtg cccgctggag gcggcgtcgc 720 tctcgacgtt tccgagagaa cgcaggtccc gatgatcgcc ggcgctgggg gtcccgtgga 780 ctccgcttgg cctccgcctc gtctgcgtca tccatcactt caaccacagc tgccctccgc 840 agctctcggg gaggcggctc cgcgcgcagg gttcacgcac acgacgtgga aatggtgggc 900 cagctcgtgg gcatcatggt ggtgtcgtgc atctgctgga gccccctgct ggtattggtg 960 gtgttggcca tcgggggctg gaactctaac tccctgcagc ggccgctctt tctggctgta 1020 cgcctcgcgt cgtggaacca gatcctggac ccatgggtgt acatcctgct gcgccaggct 1080 atgctgcgcc aacttcttcg cctcctaccc ctgagggtta gtgccaaggg tggtccaacg 1140 gagctgagcc taaccaagag tgcctgggag gccagttcac tgcgtagctc ccggcacagt 1200 ggcttcagcc acttgtga 1218//Output file format Output files for usage example File: rnu68037.newcpgreportID RNU68037 1218 BP.XXDE CpG Island report.XXCC Obs/Exp ratio > 0.60.CC % C + % G > 50.00.CC Length > 200.XXFH Key Location/QualifiersFT CpG island 104..509FT /size=406FT /Sum C+G=269FT /Percent CG=66.26FT /ObsExp=0.81FT CpG island 596..924FT /size=329FT /Sum C+G=223FT /Percent CG=67.78FT /ObsExp=1.01FT numislands 2//Data files None.Notes None.References 1. Larsen F., Gundersen, G., Lopez L., Prydz H. "CpG island as Gene Markers in the Human Genome" Genomics 13:1095-1107 (1992)Warnings None.Diagnostic Error Messages None.Exit status It always exits with a status of 0.Known bugs None.See also Program name Description cpgplot Plot CpG rich areas cpgreport Reports all CpG rich regions geecee Calculates fractional GC content of nucleic acid sequences newcpgseek Reports CpG rich regions As there is no official definition of what is a cpg island is, and worst where they begin and end, we have to live with 2 definitions and thus two methods. These are: 1. newcpgseek and cpgreport - both declare a putative island if the score is higher than a threshold (17 at the moment). They now also display the actual CpG count, the % CG and the observed/expected ration in the region where the score is above the threshold. This scoring method based on sum/frequencies overpredicts islands but finds the smaller ones around primary exons. newcpgseek uses the same method as cpgreport but the output is different and more readable. 2. newcpgreport and cpgplot use the method which mentioned in the Description section above. The important thing to note in this method is that an island, in order to be reported, is defined as a region that satisfies the following contraints: Obs/Exp ratio > 0.6 % C + % G > 50% Length > 200. For all practical purposes you should probably use newcpgreport. It is actually used to produce the human cpgisland database you can find on the EBI's ftp server as well as on the EBI's SRS server. geecee measures CG content in the entire input sequence and is not to be used to detect CpG islands. It can be useful for detecting sequences that MIGHT contain an island.Author(s) Rodrigo Lopez (rls
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?