recoder.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 369 行
TXT
369 行
recoder Function Remove restriction sites but maintain same translationDescription recoder scans a given nucleotide sequence for restriction sites. It reports single base positions in the restriction pattern which when mutated remove the restriction site whilst maintaining the same translation (in frame 1 of the input sequence). Several restriction enzymes can be specified or alternatively all the enzymes in the REBASE database can be investigated. To find out whether the single point mutations found by 'recoder', introduce new restriction sites, 'silent' should be run on the original sequence. ('Silent' searches for silent point mutation sites which maintain the same translation. The output for 'recoder' is similar to the format used by 'silent'.Usage Here is a sample session with recoder% recoder Remove restriction sites but maintain same translationInput nucleotide sequence: tembl:hsfauComma separated enzyme list [all]: EcoRIIOutput report [hsfau.recoder]: Go to the input files for this example Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-sequence] sequence Nucleotide sequence filename and optional format, or reference (input USA) -enzymes string [all] Comma separated enzyme list (Any string is accepted) [-outfile] report [*.recoder] Output report file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -sshow boolean [N] Display untranslated sequence -tshow boolean [N] Display translated sequence Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of the sequence to be used -send1 integer End of the sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -rformat2 string Report format -rname2 string Base file name -rextension2 string File name extension -rdirectory2 string Output directory -raccshow2 boolean Show accession number in the report -rdesshow2 boolean Show description in the report -rscoreshow2 boolean Show the score in the report -rusashow2 boolean Show the full USA in the report -rmaxall2 integer Maximum total hits to report -rmaxseq2 integer Maximum hits to report for one sequence General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format recoder reads a normal nucleic acid sequence USA. Input files for usage example 'tembl:hsfau' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:hsfauID HSFAU standard; RNA; HUM; 518 BP.XXAC X65923;XXSV X65923.1XXDT 13-MAY-1992 (Rel. 31, Created)DT 23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE H.sapiens fau mRNAXXKW fau gene.XXOS Homo sapiens (human)OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN [1]RP 1-518RA Michiels L.M.R.;RT ;RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN [2]RP 1-518RX MEDLINE; 93368957.RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL Oncogene 8:2537-2546(1993).XXDR SWISS-PROT; P35544; UBIM_HUMAN.DR SWISS-PROT; Q05472; RS30_HUMAN.XXFH Key Location/QualifiersFHFT source 1..518FT /chromosome="11q"FT /db_xref="taxon:9606"FT /organism="Homo sapiens"FT /tissue_type="placenta"FT /clone_lib="cDNA"FT /clone="pUIA 631"FT /map="13"FT misc_feature 57..278FT /note="ubiquitin like part"FT CDS 57..458FT /db_xref="SWISS-PROT:P35544"FT /db_xref="SWISS-PROT:Q05472"FT /gene="fau"FT /protein_id="CAA46716.1"FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT misc_feature 98..102FT /note="nucleolar localization signal"FT misc_feature 279..458FT /note="S30 part"FT polyA_signal 484..489FT polyA_site 509XXSQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518//Output file format Output files for usage example File: hsfau.recoder######################################### Program: recoder# Rundate: Sat 15 Jul 2006 12:00:00# Commandline: recoder# -sequence tembl:hsfau# -enzymes EcoRII# Report_format: table# Report_file: hsfau.recoder#########################################=======================================## Sequence: HSFAU from: 1 to: 518# HitCount: 34## KEY:# Dir: Direction (Rev for reverse complement)# EnzymeName: Enzyme name# RS-Pattern: Restriction enzyme recognition site pattern# Base-Posn: Position of base to be mutated# AAs: Amino acid. Original sequence(.)After mutation# Mutation: The base mutation to perform## Creating silent mutations##======================================= Start End Dir EnzymeName RS-Pattern Base-Posn AAs Mutation 77 81 . EcoRII CCWGG 78 P.P C->G 77 81 . EcoRII CCWGG 78 P.P C->A 77 81 . EcoRII CCWGG 78 P.P C->T 77 81 . EcoRII CCWGG 79 R.R A->C 77 81 . EcoRII CCWGG 81 R.R G->A 107 111 . EcoRII CCWGG 108 A.A C->G 107 111 . EcoRII CCWGG 108 A.A C->A 107 111 . EcoRII CCWGG 108 A.A C->T 107 111 . EcoRII CCWGG 109 R.R A->C 107 111 . EcoRII CCWGG 111 R.R G->A 182 186 . EcoRII CCWGG 183 S.S C->G 182 186 . EcoRII CCWGG 183 S.S C->A 182 186 . EcoRII CCWGG 183 S.S C->T 197 201 . EcoRII CCWGG 198 P.P C->G 197 201 . EcoRII CCWGG 198 P.P C->A 197 201 . EcoRII CCWGG 198 P.P C->T 248 252 . EcoRII CCWGG 249 P.P C->G 248 252 . EcoRII CCWGG 249 P.P C->A 248 252 . EcoRII CCWGG 249 P.P C->T 293 297 . EcoRII CCWGG 294 P.P C->G 293 297 . EcoRII CCWGG 294 P.P C->A 293 297 . EcoRII CCWGG 294 P.P C->T 81 77 Rev EcoRII CCWGG 79 P.P T->G 81 77 Rev EcoRII CCWGG 79 P.P T->C 111 107 Rev EcoRII CCWGG 109 P.P T->G 111 107 Rev EcoRII CCWGG 109 P.P T->C 186 182 Rev EcoRII CCWGG 184 P.P A->G 186 182 Rev EcoRII CCWGG 184 P.P A->C 201 197 Rev EcoRII CCWGG 199 P.P A->G 201 197 Rev EcoRII CCWGG 199 P.P A->C 252 248 Rev EcoRII CCWGG 250 P.P A->G 252 248 Rev EcoRII CCWGG 250 P.P A->C 297 293 Rev EcoRII CCWGG 295 P.P A->G 297 293 Rev EcoRII CCWGG 295 P.P A->C#---------------------------------------#---------------------------------------#---------------------------------------# Total_sequences: 1# Total_hitcount: 34#---------------------------------------Data files EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA. To see the available EMBOSS data files, run:% embossdata -showall To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run:% embossdata -fetch -file Exxx.dat Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata". The directories are searched in the following order: * . (your current directory) * .embossdata (under your current directory) * ~/ (your home directory) * ~/.embossdata The EMBOSS REBASE restriction enzyme data files are stored iin directory 'data/REBASE/*' under the EMBOSS installation directory. These files must first be set up using the program 'rebaseextract'. Running 'rebaseextract' may be the job of your system manager. The data files are stored in the REBASE directory of the standard EMBOSS data directory. The names are: * embossre.enz Cleavage information * embossre.ref Reference/methylation information * embossre.sup Supplier information The column information is described at the top of the data files The reported enzyme from any one group of isoschizomers (the prototype) is specified in the REBASE database and the information is held in the data file 'embossre.equ'. You may edit this file to set your own preferred prototype, if you wish. The format of the file "embossre.equ" is Enzyme-name Prototype-name i.e. two columns of enzyme names separated by a space. The first name of the pair of enzymes is the name that is not preferred and the second is the preferred (prototype) name.Notes None.References None.Warnings None.Diagnostic Error Messages None.Exit status It always exits with status 0.Known bugs None.See also Program name Description redata Search REBASE for enzyme name, references, suppliers etc remap Display sequence with restriction sites, translation etc restover Find restriction enzymes producing specific overhang restrict Finds restriction enzyme cleavage sites showseq Display a sequence with features, translation etc silent Silent mutation restriction enzyme scan silent does the opposite to recoder. silent finds sites where a restriction enzyme site can be introduced without changing the translation in frame 1 of the sequence. recoder finds sites where a restriction enzyme site can be removed without changing the translation in frame 1 of the sequence.Author(s) Tim Carver (tcarver
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?