recoder.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 369 行

TXT
369
字号
                                  recoder Function   Remove restriction sites but maintain same translationDescription   recoder scans a given nucleotide sequence for restriction sites. It   reports single base positions in the restriction pattern which when   mutated remove the restriction site whilst maintaining the same   translation (in frame 1 of the input sequence).   Several restriction enzymes can be specified or alternatively all the   enzymes in the REBASE database can be investigated. To find out   whether the single point mutations found by 'recoder', introduce new   restriction sites, 'silent' should be run on the original sequence.   ('Silent' searches for silent point mutation sites which maintain the   same translation.   The output for 'recoder' is similar to the format used by 'silent'.Usage   Here is a sample session with recoder% recoder Remove restriction sites but maintain same translationInput nucleotide sequence: tembl:hsfauComma separated enzyme list [all]: EcoRIIOutput report [hsfau.recoder]:    Go to the input files for this example   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-sequence]          sequence   Nucleotide sequence filename and optional                                  format, or reference (input USA)   -enzymes            string     [all] Comma separated enzyme list (Any                                  string is accepted)  [-outfile]           report     [*.recoder] Output report file name   Additional (Optional) qualifiers: (none)   Advanced (Unprompted) qualifiers:   -sshow              boolean    [N] Display untranslated sequence   -tshow              boolean    [N] Display translated sequence   Associated qualifiers:   "-sequence" associated qualifiers   -sbegin1            integer    Start of the sequence to be used   -send1              integer    End of the sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-outfile" associated qualifiers   -rformat2           string     Report format   -rname2             string     Base file name   -rextension2        string     File name extension   -rdirectory2        string     Output directory   -raccshow2          boolean    Show accession number in the report   -rdesshow2          boolean    Show description in the report   -rscoreshow2        boolean    Show the score in the report   -rusashow2          boolean    Show the full USA in the report   -rmaxall2           integer    Maximum total hits to report   -rmaxseq2           integer    Maximum hits to report for one sequence   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   recoder reads a normal nucleic acid sequence USA.  Input files for usage example   'tembl:hsfau' is a sequence entry in the example nucleic acid database   'tembl'  Database entry: tembl:hsfauID   HSFAU      standard; RNA; HUM; 518 BP.XXAC   X65923;XXSV   X65923.1XXDT   13-MAY-1992 (Rel. 31, Created)DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)XXDE   H.sapiens fau mRNAXXKW   fau gene.XXOS   Homo sapiens (human)OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.XXRN   [1]RP   1-518RA   Michiels L.M.R.;RT   ;RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,RL   Universiteisplein 1, 2610 Wilrijk, BELGIUMXXRN   [2]RP   1-518RX   MEDLINE; 93368957.RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed asRT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";RL   Oncogene 8:2537-2546(1993).XXDR   SWISS-PROT; P35544; UBIM_HUMAN.DR   SWISS-PROT; Q05472; RS30_HUMAN.XXFH   Key             Location/QualifiersFHFT   source          1..518FT                   /chromosome="11q"FT                   /db_xref="taxon:9606"FT                   /organism="Homo sapiens"FT                   /tissue_type="placenta"FT                   /clone_lib="cDNA"FT                   /clone="pUIA 631"FT                   /map="13"FT   misc_feature    57..278FT                   /note="ubiquitin like part"FT   CDS             57..458FT                   /db_xref="SWISS-PROT:P35544"FT                   /db_xref="SWISS-PROT:Q05472"FT                   /gene="fau"FT                   /protein_id="CAA46716.1"FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGFT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGFT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"FT   misc_feature    98..102FT                   /note="nucleolar localization signal"FT   misc_feature    279..458FT                   /note="S30 part"FT   polyA_signal    484..489FT   polyA_site      509XXSQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        60     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       120     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       180     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       240     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       300     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       360     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       420     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       480     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               518//Output file format  Output files for usage example  File: hsfau.recoder######################################### Program: recoder# Rundate: Sat 15 Jul 2006 12:00:00# Commandline: recoder#    -sequence tembl:hsfau#    -enzymes EcoRII# Report_format: table# Report_file: hsfau.recoder#########################################=======================================## Sequence: HSFAU     from: 1   to: 518# HitCount: 34## KEY:# Dir: Direction (Rev for reverse complement)# EnzymeName: Enzyme name# RS-Pattern: Restriction enzyme recognition site pattern# Base-Posn: Position of base to be mutated# AAs: Amino acid. Original sequence(.)After mutation# Mutation: The base mutation to perform## Creating silent mutations##=======================================  Start     End Dir    EnzymeName RS-Pattern Base-Posn    AAs Mutation     77      81 .      EcoRII     CCWGG             78    P.P     C->G     77      81 .      EcoRII     CCWGG             78    P.P     C->A     77      81 .      EcoRII     CCWGG             78    P.P     C->T     77      81 .      EcoRII     CCWGG             79    R.R     A->C     77      81 .      EcoRII     CCWGG             81    R.R     G->A    107     111 .      EcoRII     CCWGG            108    A.A     C->G    107     111 .      EcoRII     CCWGG            108    A.A     C->A    107     111 .      EcoRII     CCWGG            108    A.A     C->T    107     111 .      EcoRII     CCWGG            109    R.R     A->C    107     111 .      EcoRII     CCWGG            111    R.R     G->A    182     186 .      EcoRII     CCWGG            183    S.S     C->G    182     186 .      EcoRII     CCWGG            183    S.S     C->A    182     186 .      EcoRII     CCWGG            183    S.S     C->T    197     201 .      EcoRII     CCWGG            198    P.P     C->G    197     201 .      EcoRII     CCWGG            198    P.P     C->A    197     201 .      EcoRII     CCWGG            198    P.P     C->T    248     252 .      EcoRII     CCWGG            249    P.P     C->G    248     252 .      EcoRII     CCWGG            249    P.P     C->A    248     252 .      EcoRII     CCWGG            249    P.P     C->T    293     297 .      EcoRII     CCWGG            294    P.P     C->G    293     297 .      EcoRII     CCWGG            294    P.P     C->A    293     297 .      EcoRII     CCWGG            294    P.P     C->T     81      77 Rev    EcoRII     CCWGG             79    P.P     T->G     81      77 Rev    EcoRII     CCWGG             79    P.P     T->C    111     107 Rev    EcoRII     CCWGG            109    P.P     T->G    111     107 Rev    EcoRII     CCWGG            109    P.P     T->C    186     182 Rev    EcoRII     CCWGG            184    P.P     A->G    186     182 Rev    EcoRII     CCWGG            184    P.P     A->C    201     197 Rev    EcoRII     CCWGG            199    P.P     A->G    201     197 Rev    EcoRII     CCWGG            199    P.P     A->C    252     248 Rev    EcoRII     CCWGG            250    P.P     A->G    252     248 Rev    EcoRII     CCWGG            250    P.P     A->C    297     293 Rev    EcoRII     CCWGG            295    P.P     A->G    297     293 Rev    EcoRII     CCWGG            295    P.P     A->C#---------------------------------------#---------------------------------------#---------------------------------------# Total_sequences: 1# Total_hitcount: 34#---------------------------------------Data files   EMBOSS data files are distributed with the application and stored in   the standard EMBOSS data directory, which is defined by the EMBOSS   environment variable EMBOSS_DATA.   To see the available EMBOSS data files, run:% embossdata -showall   To fetch one of the data files (for example 'Exxx.dat') into your   current directory for you to inspect or modify, run:% embossdata -fetch -file Exxx.dat   Users can provide their own data files in their own directories.   Project specific files can be put in the current directory, or for   tidier directory listings in a subdirectory called ".embossdata".   Files for all EMBOSS runs can be put in the user's home directory, or   again in a subdirectory called ".embossdata".   The directories are searched in the following order:     * . (your current directory)     * .embossdata (under your current directory)     * ~/ (your home directory)     * ~/.embossdata   The EMBOSS REBASE restriction enzyme data files are stored iin   directory 'data/REBASE/*' under the EMBOSS installation directory.   These files must first be set up using the program 'rebaseextract'.   Running 'rebaseextract' may be the job of your system manager.   The data files are stored in the REBASE directory of the standard   EMBOSS data directory. The names are:     * embossre.enz Cleavage information     * embossre.ref Reference/methylation information     * embossre.sup Supplier information   The column information is described at the top of the data files   The reported enzyme from any one group of isoschizomers (the   prototype) is specified in the REBASE database and the information is   held in the data file 'embossre.equ'. You may edit this file to set   your own preferred prototype, if you wish.   The format of the file "embossre.equ" is   Enzyme-name Prototype-name   i.e. two columns of enzyme names separated by a space. The first name   of the pair of enzymes is the name that is not preferred and the   second is the preferred (prototype) name.Notes   None.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It always exits with status 0.Known bugs   None.See also   Program name                       Description   redata       Search REBASE for enzyme name, references, suppliers etc   remap        Display sequence with restriction sites, translation etc   restover     Find restriction enzymes producing specific overhang   restrict     Finds restriction enzyme cleavage sites   showseq      Display a sequence with features, translation etc   silent       Silent mutation restriction enzyme scan   silent does the opposite to recoder. silent finds sites where a   restriction enzyme site can be introduced without changing the   translation in frame 1 of the sequence. recoder finds sites where a   restriction enzyme site can be removed without changing the   translation in frame 1 of the sequence.Author(s)   Tim Carver (tcarver 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?