pasteseq.txt
来自「emboss的linux版本的源代码」· 文本 代码 · 共 315 行
TXT
315 行
pasteseq Function Insert one sequence into anotherDescription This simple editing program allows you to insert one sequence into another sequence after a specified position and to then write out the results to a sequence file.Usage Here is a sample session with pasteseq To insert the sequence 'tsw:flav_nossm' after position 67 in sequence 'tsw:amir_pseae' and write the results to the file 'amir_pseae.fasta':% pasteseq tsw:amir_pseae tsw:flav_nossm -pos=67 Insert one sequence into anotheroutput sequence [amir_pseae.fasta]: Go to the input files for this example Go to the output files for this example Example 2 This does the same thing, but the output qualifier is explicitly used:% pasteseq tsw:amir_pseae tsw:flav_nossm -out=amirplus.seq -pos=67 Insert one sequence into another Go to the output files for this example Example 3 To insert the sequence 'tsw:flav_nossm' before the start of sequence 'tsw:amir_pseae' use -pos=0:% pasteseq tsw:amir_pseae tsw:flav_nossm -out=amirplus.seq -pos=0 Insert one sequence into another Go to the output files for this exampleCommand line arguments Standard (Mandatory) qualifiers: [-asequence] sequence (Gapped) sequence filename and optional format, or reference (input USA) [-bsequence] sequence Sequence to insert -pos integer [$(asequence.end)] The position in the main input sequence to insert after. To insert before the start use the position 0. (Integer 0 or more) [-outseq] seqout [.] Sequence filename and optional format (output USA) Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-asequence" associated qualifiers -sbegin1 integer Start of the sequence to be used -send1 integer End of the sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-bsequence" associated qualifiers -sbegin2 integer Start of the sequence to be used -send2 integer End of the sequence to be used -sreverse2 boolean Reverse (if DNA) -sask2 boolean Ask for begin/end/reverse -snucleotide2 boolean Sequence is nucleotide -sprotein2 boolean Sequence is protein -slower2 boolean Make lower case -supper2 boolean Make upper case -sformat2 string Input sequence format -sdbname2 string Database name -sid2 string Entryname -ufo2 string UFO features -fformat2 string Features format -fopenfile2 string Features file name "-outseq" associated qualifiers -osformat3 string Output seq format -osextension3 string File name extension -osname3 string Base file name -osdirectory3 string Output directory -osdbname3 string Database name to add -ossingle3 boolean Separate file for each entry -oufo3 string UFO features -offormat3 string Features format -ofname3 string Features file name -ofdirectory3 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messagesInput file format pasteseq reads 2 normal sequence USAs. Input files for usage example 'tsw:amir_pseae' is a sequence entry in the example protein database 'tsw' Database entry: tsw:amir_pseaeID AMIR_PSEAE STANDARD; PRT; 196 AA.AC P10932;DT 01-JUL-1989 (Rel. 11, Created)DT 01-JUL-1989 (Rel. 11, Last sequence update)DT 15-DEC-1998 (Rel. 37, Last annotation update)DE ALIPHATIC AMIDASE REGULATOR.GN AMIR.OS Pseudomonas aeruginosa.OC Bacteria; Proteobacteria; gamma subdivision; Pseudomonas group;OC Pseudomonas.RN [1]RP SEQUENCE FROM N.A.RC STRAIN=PAC;RX MEDLINE; 89211409.RA LOWE N., RICE P.M., DREW R.E.;RT "Nucleotide sequence of the aliphatic amidase regulator gene (amiR)RT of Pseudomonas aeruginosa.";RL FEBS Lett. 246:39-43(1989).RN [2]RP CHARACTERIZATION.RX MEDLINE; 95286483.RA WILSON S.A., DREW R.E.;RT "Transcriptional analysis of the amidase operon from PseudomonasRT aeruginosa.";RL J. Bacteriol. 177:3052-3057(1995).CC -!- FUNCTION: POSITIVE CONTROLLING ELEMENT OF AMIE, THE GENE FORCC ALIPHATIC AMIDASE. ACTS AS A TRANSCRIPTIONAL ANTITERMINATIONCC FACTOR. IT IS THOUGHT TO ALLOW RNA POLYMERASE READ THROUGH A RHO-CC INDEPENDENT TRANSCRIPTION TERMINATOR BETWEEN THE AMIE PROMOTER ANDCC GENE.CC --------------------------------------------------------------------------CC This SWISS-PROT entry is copyright. It is produced through a collaborationCC between the Swiss Institute of Bioinformatics and the EMBL outstation -CC the European Bioinformatics Institute. There are no restrictions on itsCC use by non-profit institutions as long as its content is in no wayCC modified and this statement is not removed. Usage by and for commercialCC entities requires a license agreement (See http://www.isb-sib.ch/announce/CC or send an email to license@isb-sib.ch).CC --------------------------------------------------------------------------DR EMBL; X13776; CAA32023.1; -.DR PIR; S03884; S03884.KW Transcription regulation; Activator.SQ SEQUENCE 196 AA; 21776 MW; 560A8AE3 CRC32; MSANSLLGSL RELQVLVLNP PGEVSDALVL QLIRIGCSVR QCWPPPEAFD VPVDVVFTSI FQNGHHDEIA ALLAAGTPRT TLVALVEYES PAVLSQIIEL ECHGVITQPL DAHRVLPVLV SARRISEEMA KLKQKTEQLQ DRIAGQARIN QAKVLLMQRH GWDEREAHQH LSREAMKRRE PILKIAQELL GNEPSA// Database entry: tsw:flav_nossmID FLAV_NOSSM STANDARD; PRT; 35 AA.AC P35707;DT 01-JUN-1994 (Rel. 29, Created)DT 01-JUN-1994 (Rel. 29, Last sequence update)DT 15-DEC-1998 (Rel. 37, Last annotation update)DE FLAVODOXIN (FRAGMENT).OS Nostoc sp. (strain MAC).OC Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.RN [1]RP SEQUENCE.RA Takruri I.A.H., Boulter D., Fitzgerald M.P., Hutber G.N., Rogers L.J.;RT "N-terminal amino acid sequences of flavodoxins from Chondrus crispusRT and Nostoc strain MAC.";RL Phytochemistry 25:2113-2115(1986).CC -!- FUNCTION: LOW-POTENTIAL ELECTRON DONOR TO A NUMBER OF REDOXCC ENZYMES.CC -!- COFACTOR: FMN.CC -!- SIMILARITY: BELONGS TO THE FLAVODOXIN FAMILY.DR PIR; PA0004; PA0004.DR HSSP; P11241; 1RCF.DR INTERPRO; IPR001226; -.DR PFAM; PF00258; flavodoxin; 1.DR PROSITE; PS00201; FLAVODOXIN; 1.KW Electron transport; Flavoprotein; FMN.FT NON_TER 35 35SQ SEQUENCE 35 AA; 3820 MW; B6EEB5CA7A45DDA6 CRC64; SKKIGLFYGT ZTGKTESVAE IIDEFGDEVV TLDID//Output file format pasteseq writes a normal sequence file. Output files for usage example File: amir_pseae.fasta>AMIR_PSEAE ALIPHATIC AMIDASE REGULATOR.MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNGHHDSKKIGLFYGTZTGKTESVAEIIDEFGDEVVTLDIDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSA Output files for usage example 2 File: amirplus.seq>AMIR_PSEAE ALIPHATIC AMIDASE REGULATOR.MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNGHHDSKKIGLFYGTZTGKTESVAEIIDEFGDEVVTLDIDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSA Output files for usage example 3 File: amirplus.seq>AMIR_PSEAE ALIPHATIC AMIDASE REGULATOR.SKKIGLFYGTZTGKTESVAEIIDEFGDEVVTLDIDMSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNGHHDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSAData files None.Notes This can be used as a simple sequence editor.References None.Warnings None.Diagnostic Error Messages None.Exit status It always exits with status 0.Known bugs None.See also Program name Description biosed Replace or delete sequence sections codcopy Reads and writes a codon usage table cutseq Removes a specified section from a sequence degapseq Removes gap characters from sequences descseq Alter the name or description of a sequence entret Reads and writes (returns) flatfile entries extractalign Extract regions from a sequence alignment extractfeat Extract features from a sequence extractseq Extract regions from a sequence listor Write a list file of the logical OR of two sets of sequences makenucseq Creates random nucleotide sequences makeprotseq Creates random protein sequences maskfeat Mask off features of a sequence maskseq Mask off regions of a sequence newseq Type in a short new sequence noreturn Removes carriage return from ASCII files notseq Exclude a set of sequences and write out the remaining ones nthseq Writes one sequence from a multiple set of sequences revseq Reverse and complement a sequence seqret Reads and writes (returns) sequences seqretsplit Reads and writes (returns) sequences in individual files skipseq Reads and writes (returns) sequences, skipping first few splitter Split a sequence into (overlapping) smaller sequences trimest Trim poly-A tails off EST sequences trimseq Trim ambiguous bits off the ends of sequences union Reads sequence fragments and builds one sequence vectorstrip Strips out DNA between a pair of vector sequences yank Reads a sequence range, appends the full USA to a list fileAuthor(s) Gary Williams (gwilliam
⌨️ 快捷键说明
复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?