pasteseq.txt

来自「emboss的linux版本的源代码」· 文本 代码 · 共 315 行

TXT
315
字号
                                 pasteseq Function   Insert one sequence into anotherDescription   This simple editing program allows you to insert one sequence into   another sequence after a specified position and to then write out the   results to a sequence file.Usage   Here is a sample session with pasteseq   To insert the sequence 'tsw:flav_nossm' after position 67 in sequence   'tsw:amir_pseae' and write the results to the file 'amir_pseae.fasta':% pasteseq tsw:amir_pseae tsw:flav_nossm -pos=67 Insert one sequence into anotheroutput sequence [amir_pseae.fasta]:    Go to the input files for this example   Go to the output files for this example   Example 2   This does the same thing, but the output qualifier is explicitly used:% pasteseq tsw:amir_pseae tsw:flav_nossm -out=amirplus.seq -pos=67 Insert one sequence into another   Go to the output files for this example   Example 3   To insert the sequence 'tsw:flav_nossm' before the start of sequence   'tsw:amir_pseae' use -pos=0:% pasteseq tsw:amir_pseae tsw:flav_nossm -out=amirplus.seq -pos=0 Insert one sequence into another   Go to the output files for this exampleCommand line arguments   Standard (Mandatory) qualifiers:  [-asequence]         sequence   (Gapped) sequence filename and optional                                  format, or reference (input USA)  [-bsequence]         sequence   Sequence to insert   -pos                integer    [$(asequence.end)] The position in the main                                  input sequence to insert after.                                  To insert before the start use the position                                  0. (Integer 0 or more)  [-outseq]            seqout     [.] Sequence filename and                                  optional format (output USA)   Additional (Optional) qualifiers: (none)   Advanced (Unprompted) qualifiers: (none)   Associated qualifiers:   "-asequence" associated qualifiers   -sbegin1            integer    Start of the sequence to be used   -send1              integer    End of the sequence to be used   -sreverse1          boolean    Reverse (if DNA)   -sask1              boolean    Ask for begin/end/reverse   -snucleotide1       boolean    Sequence is nucleotide   -sprotein1          boolean    Sequence is protein   -slower1            boolean    Make lower case   -supper1            boolean    Make upper case   -sformat1           string     Input sequence format   -sdbname1           string     Database name   -sid1               string     Entryname   -ufo1               string     UFO features   -fformat1           string     Features format   -fopenfile1         string     Features file name   "-bsequence" associated qualifiers   -sbegin2            integer    Start of the sequence to be used   -send2              integer    End of the sequence to be used   -sreverse2          boolean    Reverse (if DNA)   -sask2              boolean    Ask for begin/end/reverse   -snucleotide2       boolean    Sequence is nucleotide   -sprotein2          boolean    Sequence is protein   -slower2            boolean    Make lower case   -supper2            boolean    Make upper case   -sformat2           string     Input sequence format   -sdbname2           string     Database name   -sid2               string     Entryname   -ufo2               string     UFO features   -fformat2           string     Features format   -fopenfile2         string     Features file name   "-outseq" associated qualifiers   -osformat3          string     Output seq format   -osextension3       string     File name extension   -osname3            string     Base file name   -osdirectory3       string     Output directory   -osdbname3          string     Database name to add   -ossingle3          boolean    Separate file for each entry   -oufo3              string     UFO features   -offormat3          string     Features format   -ofname3            string     Features file name   -ofdirectory3       string     Output directory   General qualifiers:   -auto               boolean    Turn off prompts   -stdout             boolean    Write standard output   -filter             boolean    Read standard input, write standard output   -options            boolean    Prompt for standard and additional values   -debug              boolean    Write debug output to program.dbg   -verbose            boolean    Report some/full command line options   -help               boolean    Report command line options. More                                  information on associated and general                                  qualifiers can be found with -help -verbose   -warning            boolean    Report warnings   -error              boolean    Report errors   -fatal              boolean    Report fatal errors   -die                boolean    Report dying program messagesInput file format   pasteseq reads 2 normal sequence USAs.  Input files for usage example   'tsw:amir_pseae' is a sequence entry in the example protein database   'tsw'  Database entry: tsw:amir_pseaeID   AMIR_PSEAE     STANDARD;      PRT;   196 AA.AC   P10932;DT   01-JUL-1989 (Rel. 11, Created)DT   01-JUL-1989 (Rel. 11, Last sequence update)DT   15-DEC-1998 (Rel. 37, Last annotation update)DE   ALIPHATIC AMIDASE REGULATOR.GN   AMIR.OS   Pseudomonas aeruginosa.OC   Bacteria; Proteobacteria; gamma subdivision; Pseudomonas group;OC   Pseudomonas.RN   [1]RP   SEQUENCE FROM N.A.RC   STRAIN=PAC;RX   MEDLINE; 89211409.RA   LOWE N., RICE P.M., DREW R.E.;RT   "Nucleotide sequence of the aliphatic amidase regulator gene (amiR)RT   of Pseudomonas aeruginosa.";RL   FEBS Lett. 246:39-43(1989).RN   [2]RP   CHARACTERIZATION.RX   MEDLINE; 95286483.RA   WILSON S.A., DREW R.E.;RT   "Transcriptional analysis of the amidase operon from PseudomonasRT   aeruginosa.";RL   J. Bacteriol. 177:3052-3057(1995).CC   -!- FUNCTION: POSITIVE CONTROLLING ELEMENT OF AMIE, THE GENE FORCC       ALIPHATIC AMIDASE. ACTS AS A TRANSCRIPTIONAL ANTITERMINATIONCC       FACTOR. IT IS THOUGHT TO ALLOW RNA POLYMERASE READ THROUGH A RHO-CC       INDEPENDENT TRANSCRIPTION TERMINATOR BETWEEN THE AMIE PROMOTER ANDCC       GENE.CC   --------------------------------------------------------------------------CC   This SWISS-PROT entry is copyright. It is produced through a collaborationCC   between  the Swiss Institute of Bioinformatics  and the  EMBL outstation -CC   the European Bioinformatics Institute.  There are no  restrictions on  itsCC   use  by  non-profit  institutions as long  as its content  is  in  no  wayCC   modified and this statement is not removed.  Usage  by  and for commercialCC   entities requires a license agreement (See http://www.isb-sib.ch/announce/CC   or send an email to license@isb-sib.ch).CC   --------------------------------------------------------------------------DR   EMBL; X13776; CAA32023.1; -.DR   PIR; S03884; S03884.KW   Transcription regulation; Activator.SQ   SEQUENCE   196 AA;  21776 MW;  560A8AE3 CRC32;     MSANSLLGSL RELQVLVLNP PGEVSDALVL QLIRIGCSVR QCWPPPEAFD VPVDVVFTSI     FQNGHHDEIA ALLAAGTPRT TLVALVEYES PAVLSQIIEL ECHGVITQPL DAHRVLPVLV     SARRISEEMA KLKQKTEQLQ DRIAGQARIN QAKVLLMQRH GWDEREAHQH LSREAMKRRE     PILKIAQELL GNEPSA//  Database entry: tsw:flav_nossmID   FLAV_NOSSM     STANDARD;      PRT;    35 AA.AC   P35707;DT   01-JUN-1994 (Rel. 29, Created)DT   01-JUN-1994 (Rel. 29, Last sequence update)DT   15-DEC-1998 (Rel. 37, Last annotation update)DE   FLAVODOXIN (FRAGMENT).OS   Nostoc sp. (strain MAC).OC   Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.RN   [1]RP   SEQUENCE.RA   Takruri I.A.H., Boulter D., Fitzgerald M.P., Hutber G.N., Rogers L.J.;RT   "N-terminal amino acid sequences of flavodoxins from Chondrus crispusRT   and Nostoc strain MAC.";RL   Phytochemistry 25:2113-2115(1986).CC   -!- FUNCTION: LOW-POTENTIAL ELECTRON DONOR TO A NUMBER OF REDOXCC       ENZYMES.CC   -!- COFACTOR: FMN.CC   -!- SIMILARITY: BELONGS TO THE FLAVODOXIN FAMILY.DR   PIR; PA0004; PA0004.DR   HSSP; P11241; 1RCF.DR   INTERPRO; IPR001226; -.DR   PFAM; PF00258; flavodoxin; 1.DR   PROSITE; PS00201; FLAVODOXIN; 1.KW   Electron transport; Flavoprotein; FMN.FT   NON_TER      35     35SQ   SEQUENCE   35 AA;  3820 MW;  B6EEB5CA7A45DDA6 CRC64;     SKKIGLFYGT ZTGKTESVAE IIDEFGDEVV TLDID//Output file format   pasteseq writes a normal sequence file.  Output files for usage example  File: amir_pseae.fasta>AMIR_PSEAE ALIPHATIC AMIDASE REGULATOR.MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNGHHDSKKIGLFYGTZTGKTESVAEIIDEFGDEVVTLDIDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSA  Output files for usage example 2  File: amirplus.seq>AMIR_PSEAE ALIPHATIC AMIDASE REGULATOR.MSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNGHHDSKKIGLFYGTZTGKTESVAEIIDEFGDEVVTLDIDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSA  Output files for usage example 3  File: amirplus.seq>AMIR_PSEAE ALIPHATIC AMIDASE REGULATOR.SKKIGLFYGTZTGKTESVAEIIDEFGDEVVTLDIDMSANSLLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFDVPVDVVFTSIFQNGHHDEIAALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKIAQELLGNEPSAData files   None.Notes   This can be used as a simple sequence editor.References   None.Warnings   None.Diagnostic Error Messages   None.Exit status   It always exits with status 0.Known bugs   None.See also   Program name                         Description   biosed       Replace or delete sequence sections   codcopy      Reads and writes a codon usage table   cutseq       Removes a specified section from a sequence   degapseq     Removes gap characters from sequences   descseq      Alter the name or description of a sequence   entret       Reads and writes (returns) flatfile entries   extractalign Extract regions from a sequence alignment   extractfeat  Extract features from a sequence   extractseq   Extract regions from a sequence   listor       Write a list file of the logical OR of two sets of sequences   makenucseq   Creates random nucleotide sequences   makeprotseq  Creates random protein sequences   maskfeat     Mask off features of a sequence   maskseq      Mask off regions of a sequence   newseq       Type in a short new sequence   noreturn     Removes carriage return from ASCII files   notseq       Exclude a set of sequences and write out the remaining ones   nthseq       Writes one sequence from a multiple set of sequences   revseq       Reverse and complement a sequence   seqret       Reads and writes (returns) sequences   seqretsplit  Reads and writes (returns) sequences in individual files   skipseq      Reads and writes (returns) sequences, skipping first few   splitter     Split a sequence into (overlapping) smaller sequences   trimest      Trim poly-A tails off EST sequences   trimseq      Trim ambiguous bits off the ends of sequences   union        Reads sequence fragments and builds one sequence   vectorstrip  Strips out DNA between a pair of vector sequences   yank         Reads a sequence range, appends the full USA to a list fileAuthor(s)   Gary Williams (gwilliam 

⌨️ 快捷键说明

复制代码Ctrl + C
搜索代码Ctrl + F
全屏模式F11
增大字号Ctrl + =
减小字号Ctrl + -
显示快捷键?