localstrings.properties

业界著名的tomcat服务器的最新6.0的源代码。

jsp.error.include.flush.invalid.value=Invalid value for the flush attribute: {0}
jsp.error.unsupported.encoding=Unsupported encoding: {0}
tld.error.variableNotAllowed=It is an error for a tag that has one or more variable subelements to have a TagExtraInfo class that returns a non-null object.
jsp.error.tldInWebDotXmlNotFound=Could not locate TLD {1} for URI {0} specified in web.xml
jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: {0} cannot be resolved in either web.xml or the jar files deployed with this application
jsp.error.taglibDirective.missing.location=Neither \'uri\' nor \'tagdir\' attribute specified
jsp.error.taglibDirective.both_uri_and_tagdir=Both \'uri\' and \'tagdir\' attributes specified
jsp.error.invalid.tagdir=Tag file directory {0} does not start with \"/WEB-INF/tags\"
jsp.error.unterminated.user.tag=Unterminated user-defined tag: ending tag {0} not found or incorrectly nested
#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}> cannot have template data. Template data must be encapsulated within a <jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: {1}
jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}> cannot have template data. Template data must be encapsulated within a <jsp:text> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: {1}
#Error while processing taglib jar file {0}: {1}
jsp.error.taglib.reserved.prefix=The taglib prefix {0} is reserved
jsp.error.invalid.javaEncoding=Invalid java encodings. Tried {0} and then {1}. Both failed.
jsp.error.needAlternateJavaEncoding=Default java encoding {0} is invalid on your java platform. An alternate can be specified via the 'javaEncoding' parameter of JspServlet.
#Error when compiling, used for jsp line number error messages
jsp.error.single.line.number=An error occurred at line: {0} in the jsp file: {1}
jsp.error.multiple.line.number=\n\nAn error occurred between lines: {0} and {1} in the jsp file: {2}\n\n
jsp.error.corresponding.servlet=Generated servlet error:\n
jsp.error.empty.body.not.allowed=Empty body not allowed for {0}
jsp.error.jspbody.required=Must use jsp:body to specify tag body for {0} if jsp:attribute is used.
jsp.error.jspbody.emptybody.only=The {0} tag can only have jsp:attribute in its body.
jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration, <%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed here.
jsp.error.internal.unexpected_node_type=Internal Error: Unexpected node type encountered
jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD.  Tag Library: {0}, Function: {1}
jsp.error.tld.fn.duplicate.name=Duplicate function name {0} in tag library {1}
jsp.error.tld.fn.invalid.signature.commaexpected=Invalid syntax for function signature in TLD.  Comma ',' expected.  Tag Library: {0}, Function: {1}.
jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function signature in TLD.  Parenthesis '(' expected.  Tag Library: {0}, Function: {1}.
jsp.error.tld.mandatory.element.missing=Mandatory TLD element missing or empty: {0}
jsp.error.dynamic.attributes.not.implemented=The {0} tag declares that it accepts dynamic attributes but does not implement the required interface
jsp.error.nomatching.fragment=Cannot find an attribute directive (with name={0} and fragment=true) prior to the fragment directive.
jsp.error.attribute.noequal=equal symbol expected
jsp.error.attribute.noquote=quote symbol expected
jsp.error.attribute.unterminated=attribute for {0} is not properly terminated
jsp.error.missing.tagInfo=TagInfo object for {0} is missing from TLD
jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature if 'deferredMethod' is not 'true'
jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if 'deferredValue' is not 'true'
jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot be both 'true'
jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type' attributes.  If 'fragment' is present, 'type' is fixed as 'javax.servlet.jsp.tagext.JspFragment'
jsp.error.fragmentwithrtexprvalue=Cannot specify both 'fragment' and 'rtexprvalue' attributes.  If 'fragment' is present, 'rtexprvalue' is fixed as 'true'
jsp.error.fragmentWithDeclareOrScope=Both 'fragment' and 'declare' or 'scope' attributes specified in variable directive
jsp.error.var_and_varReader=Only one of \'var\' or \'varReader\' may be specified
jsp.error.missing_var_or_varReader=Missing \'var\' or \'varReader\' attribute
jsp.warning.bad.urlpattern.propertygroup=Bad value {0} in the url-pattern subelement in web.xml
jsp.error.unknown_attribute_type=Unknown attribute type ({1}) for attribute {0}.
jsp.error.coerce_to_type=Cannot coerce value ({2}) to type ({1}) for attribute {0}.
jsp.error.jspelement.missing.name=Mandatory XML-style \'name\' attribute missing
jsp.error.xmlns.redefinition.notimplemented=Internal error: Attempt to redefine xmlns:{0}.  Redefinition of namespaces is not implemented.
jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries.
jsp.error.duplicate.name.jspattribute=The attribute {0} specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute
jsp.error.not.in.template={0} not allowed in a template text body.
jsp.error.badStandardAction=Invalid standard action
jsp.error.xml.badStandardAction=Invalid standard action: {0}
jsp.error.tagdirective.badbodycontent=Invalid body-content ({0}) in tag directive
jsp.error.simpletag.badbodycontent=The TLD for the class {0} specifies an invalid body-content (JSP) for a SimpleTag.
jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group ({0}) is different from that specified in page directive ({1})
jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog ({0}) is different from that specified in page directive ({1})
jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog ({0}) is different from that specified in jsp-property-group ({1})
jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute {0} does not accept any expressions
jsp.error.attribute.standard.non_rt_with_expr=The {0} attribute of the {1} standard action does not accept any expressions
jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute {0}
jasper.error.emptybodycontent.nonempty=According to TLD, tag {0} must be empty, but is not
jsp.error.tagfile.nameNotUnique=The value of {0} and the value of {1} in line {2} are the same.
jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name attribute with a value \"{0}\", the value of this name-from-attribute attribute.
jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line {1} and whose name attribute is \"{0}\", the value of this name-from-attribute attribute) must be of type java.lang.String, is \"required\" and not a \"rtexprvalue\".
jsp.error.page.noSession=Cannot access session scope in page that does not participate in any session
jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page declares (via page directive) that it does not participate in sessions
jsp.error.xml.encodingByteOrderUnsupported = Given byte order for encoding \"{0}\" is not supported.
jsp.error.xml.encodingDeclInvalid = Invalid encoding name \"{0}\".
jsp.error.xml.encodingDeclRequired = The encoding declaration is required in the text declaration.
jsp.error.xml.morePseudoAttributes = more pseudo attributes is expected.
jsp.error.xml.noMorePseudoAttributes = no more pseudo attributes is allowed.
jsp.error.xml.versionInfoRequired = The version is required in the XML declaration.
jsp.error.xml.xmlDeclUnterminated = The XML declaration must end with \"?>\".
jsp.error.xml.reservedPITarget = The processing instruction target matching \"[xX][mM][lL]\" is not allowed.
jsp.error.xml.spaceRequiredInPI = White space is required between the processing instruction target and data.
jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x{0}) was found in the element content of the document.
jsp.error.xml.spaceRequiredBeforeStandalone = White space is required before the encoding pseudo attribute in the XML declaration.
jsp.error.xml.sdDeclInvalid = The standalone document declaration value must be \"yes\" or \"no\", not \"{0}\".
jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x{0}) was found in the processing instruction.
jsp.error.xml.versionNotSupported = XML version \"{0}\" is not supported, only XML 1.0 is supported.
jsp.error.xml.pseudoAttrNameExpected = a pseudo attribute name is expected.
jsp.error.xml.expectedByte = Expected byte {0} of {1}-byte UTF-8 sequence.
jsp.error.xml.invalidByte = Invalid byte {0} of {1}-byte UTF-8 sequence.
jsp.error.xml.operationNotSupported = Operation \"{0}\" not supported by {1} reader.
jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x{0}.
jsp.error.xml.invalidASCII = Byte \"{0}\" not 7-bit ASCII.
jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = White space is required before the encoding pseudo attribute in the XML declaration.
jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = White space is required before the encoding pseudo attribute in the text declaration.
jsp.error.xml.spaceRequiredBeforeVersionInTextDecl = White space is required before the version pseudo attribute in the text declaration.
jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl = White space is required before the version pseudo attribute in the XML declaration.
jsp.error.xml.eqRequiredInXMLDecl = The '' = '' character must follow \"{0}\" in the XML declaration.
jsp.error.xml.eqRequiredInTextDecl = The '' = '' character must follow \"{0}\" in the text declaration.
jsp.error.xml.quoteRequiredInTextDecl = The value following \"{0}\" in the text declaration must be a quoted string.
jsp.error.xml.quoteRequiredInXMLDecl = The value following \"{0}\" in the XML declaration must be a quoted string.
jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode: 0x{0}) was found in the text declaration.
jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x{0}) was found in the XML declaration.
jsp.error.xml.closeQuoteMissingInTextDecl = closing quote in the value following \"{0}\" in the text declaration is missing.
jsp.error.xml.closeQuoteMissingInXMLDecl = closing quote in the value following \"{0}\" in the XML declaration is missing.
jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x{0}.
jsp.error.multiple.jsp = Cannot have multiple specifications of 
jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple occurrences of \"{0}\" with different values (old: {1}, new: {2})
jsp.error.jspoutput.doctypenamesystem=<jsp:output>: 'doctype-root-element' and 'doctype-system' attributes must appear together
jsp.error.jspoutput.doctypepulicsystem=<jsp:output>: 'doctype-system' attribute must appear if 'doctype-public' attribute appears
jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body
jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard syntax
jsp.error.attributes.not.allowed = {0} must not have any attributes
jsp.error.tagfile.badSuffix=Missing \".tag\" suffix in tag file path {0}
jsp.error.tagfile.illegalPath=Illegal tag file path: {0}, must start with \"/WEB-INF/tags\" or \"/META-INF/tags\"
jsp.error.plugin.wrongRootElement=Name of root element in {0} different from {1}
jsp.error.attribute.invalidPrefix=The attribute prefix {0} does not correspond to any imported tag library
jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within another jsp:attribute standard action
jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another jsp:body or jsp:attribute standard action
jsp.error.variable.either.name=Either name-given or name-from-attribute attribute must be specified in a variable directive
jsp.error.variable.both.name=Cannot specify both name-given or name-from-attribute attributes in a variable directive
jsp.error.variable.alias=Both or none of the name-from-attribute and alias attributes must be specified in a variable directive
jsp.error.attribute.null_name=Null attribute name
jsp.error.jsptext.badcontent=\'<\', when appears in the body of <jsp:text>, must be encapsulated within a CDATA
jsp.error.jsproot.version.invalid=Invalid version number: \"{0}\", must be \"1.2\", \"2.0\", or  \"2.1\"
jsp.error.noFunctionPrefix=The function {0} must be used with a prefix when a default namespace is not specified
jsp.error.noFunction=The function {0} cannot be located with the specified prefix
jsp.error.noFunctionMethod=Method \"{0}\" for function \"{1}\" not found in class \"{2}\"
jsp.error.function.classnotfound=The class {0} specified in TLD for the function {1} cannot be found: {2}
jsp.error.signature.classnotfound=The class {0} specified in the method signature in TLD for the function {1} cannot be found. {2}
jsp.error.text.has_subelement=<jsp:text> must not have any subelements
jsp.error.data.file.read=Error reading file \"{0}\"
jsp.error.prefix.refined=Attempt to redefine the prefix {0} to {1}, when it was already defined as {2} in the current scope.
jsp.error.nested_jsproot=Nested <jsp:root>
jsp.error.unbalanced.endtag=The end tag \"</{0}\" is unbalanced
jsp.error.invalid.bean=The value for the useBean class attribute {0} is invalid.
jsp.error.prefix.use_before_dcl=The prefix {0} specified in this tag directive has been previously used by an action in file {1} line {2}.

jsp.exception=An exception occurred processing JSP page {0} at line {1}

# JSP 2.1
jsp.error.el.template.deferred=#{..} is not allowed in template text
jsp.error.el.parse={0} : {1}
jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid value for deferredSyntaxAllowedAsLiteral
jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for deferredSyntaxAllowedAsLiteral
jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal to have multiple occurrences of 'deferredSyntaxAllowedAsLiteral' with different values (old: {0}, new: {1})
jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of 'deferredSyntaxAllowedAsLiteral' with different values (old: {0}, new: {1})

jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value for trimDirectiveWhitespaces
jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for trimDirectiveWhitespaces
jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to have multiple occurrences of 'trimDirectiveWhitespaces' with different values (old: {0}, new: {1})
jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of 'trimDirectiveWhitespaces' with different values (old: {0}, new: {1})